CARD9 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CARD9 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CARD9 (mGFP-tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CARD9 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human caspase recruitment domain family, member 9 (CARD9), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CARD9 (GFP-tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CARD9 (Myc-DDK tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CARD9 (mGFP-tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, CARD9 (Myc-DDK tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CARD9 (mGFP-tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CARD9 (Myc-DDK tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CARD9 (Myc-DDK tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CARD9 (mGFP-tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CARD9 (GFP-tagged) - Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
CARD9 (untagged)-Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CARD9 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CARD9 antibody: synthetic peptide directed towards the middle region of human CARD9. Synthetic peptide located within the following region: ALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWR |
Lenti ORF clone of Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CARD9 (untagged)-Human caspase recruitment domain family, member 9 (CARD9), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CARD9 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of caspase recruitment domain family, member 9 (CARD9), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal CARD9 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CARD9 antibody was raised against a synthetic peptide corresponding to amino acids 521 to 536 of human CARD9 The sequence is different from that of rat origin by two amino acids. |
Carrier-free (BSA/glycerol-free) CARD9 mouse monoclonal antibody,clone OTI3F8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CARD9 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of caspase recruitment domain family, member 9 (CARD9), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CARD9 MS Standard C13 and N15-labeled recombinant protein (NP_434700)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CARD9 MS Standard C13 and N15-labeled recombinant protein (NP_434701)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-CARD9 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CARD9 |
CARD9 mouse monoclonal antibody,clone OTI3F8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CARD9 mouse monoclonal antibody,clone OTI3F8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
CARD9 mouse monoclonal antibody,clone OTI3F8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CARD9 mouse monoclonal antibody,clone OTI3F8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of CARD9 (NM_052813) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CARD9 (NM_052814) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CARD9 (NM_052813) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CARD9 (NM_052813) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CARD9 (NM_052814) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CARD9 (NM_052814) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack