SHC4 (Myc-DDK-tagged)-Human SHC (Src homology 2 domain containing) family, member 4 (SHC4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SHC4 (Myc-DDK-tagged)-Human SHC (Src homology 2 domain containing) family, member 4 (SHC4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, SHC4 (Myc-DDK tagged) - Human SHC (Src homology 2 domain containing) family, member 4 (SHC4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, SHC4 (mGFP-tagged) - Human SHC (Src homology 2 domain containing) family, member 4 (SHC4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human SHC (Src homology 2 domain containing) family, member 4 (SHC4)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
SHC4 (GFP-tagged) - Human SHC (Src homology 2 domain containing) family, member 4 (SHC4)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human SHC (Src homology 2 domain containing) family, member 4 (SHC4), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SHC4 (Myc-DDK tagged) - Human SHC (Src homology 2 domain containing) family, member 4 (SHC4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human SHC (Src homology 2 domain containing) family, member 4 (SHC4), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SHC4 (mGFP-tagged) - Human SHC (Src homology 2 domain containing) family, member 4 (SHC4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human SHC (Src homology 2 domain containing) family, member 4 (SHC4), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human SHC (Src homology 2 domain containing) family, member 4 (SHC4), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
SHC4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of SHC (Src homology 2 domain containing) family, member 4 (SHC4)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
SHC4 (untagged)-Human SHC (Src homology 2 domain containing) family, member 4 (SHC4)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal antibody to SHC4 (SHC (Src homology 2 domain containing) family, member 4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 352 and 630 of SHC4 (Uniprot ID#Q6S5L8) |
Rabbit Polyclonal Anti-SHC4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SHC4 antibody is: synthetic peptide directed towards the N-terminal region of Human SHC4. Synthetic peptide located within the following region: NPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRSGTAPPP |
SHC4 MS Standard C13 and N15-labeled recombinant protein (NP_976224)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of SHC4 (NM_203349) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SHC4 (NM_203349) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SHC4 (NM_203349) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack