Products

View as table Download

SHC4 (Myc-DDK-tagged)-Human SHC (Src homology 2 domain containing) family, member 4 (SHC4)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, SHC4 (Myc-DDK tagged) - Human SHC (Src homology 2 domain containing) family, member 4 (SHC4), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, SHC4 (mGFP-tagged) - Human SHC (Src homology 2 domain containing) family, member 4 (SHC4), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Recombinant protein of human SHC (Src homology 2 domain containing) family, member 4 (SHC4)

Tag C-Myc/DDK
Expression Host HEK293T

SHC4 (GFP-tagged) - Human SHC (Src homology 2 domain containing) family, member 4 (SHC4)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human SHC (Src homology 2 domain containing) family, member 4 (SHC4), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SHC4 (Myc-DDK tagged) - Human SHC (Src homology 2 domain containing) family, member 4 (SHC4), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human SHC (Src homology 2 domain containing) family, member 4 (SHC4), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SHC4 (mGFP-tagged) - Human SHC (Src homology 2 domain containing) family, member 4 (SHC4), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human SHC (Src homology 2 domain containing) family, member 4 (SHC4), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human SHC (Src homology 2 domain containing) family, member 4 (SHC4), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

SHC4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

SHC4 (untagged)-Human SHC (Src homology 2 domain containing) family, member 4 (SHC4)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal antibody to SHC4 (SHC (Src homology 2 domain containing) family, member 4)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 352 and 630 of SHC4 (Uniprot ID#Q6S5L8)

Rabbit Polyclonal Anti-SHC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SHC4 antibody is: synthetic peptide directed towards the N-terminal region of Human SHC4. Synthetic peptide located within the following region: NPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRSGTAPPP

SHC4 MS Standard C13 and N15-labeled recombinant protein (NP_976224)

Tag C-Myc/DDK
Expression Host HEK293

Transient overexpression of SHC4 (NM_203349) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of SHC4 (NM_203349) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of SHC4 (NM_203349) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack