Products

View as table Download

Rabbit Polyclonal Anti-ADCYAP1R1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ADCYAP1R1 / PAC1 Receptor antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human ADCYAP1R1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Elephant (100%); Gorilla, Panda, Pig (94%); Bovine, Dog (88%); Horse (82%).

Rabbit Polyclonal Anti-ADCYAP1R1 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADCYAP1R1 antibody: synthetic peptide directed towards the C terminal of human ADCYAP1R1. Synthetic peptide located within the following region: NESSIYLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQ

Anti-ADCYAP1R1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 34-47 amino acids of Human adenylate cyclase activating polypeptide 1 (pituitary) receptor type I