Germany
Japan
United Kingdom
China
CA4 (Myc-DDK-tagged)-Human carbonic anhydrase IV (CA4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human carbonic anhydrase IV (CA4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, CA4 (Myc-DDK tagged) - Human carbonic anhydrase IV (CA4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, CA4 (mGFP-tagged) - Human carbonic anhydrase IV (CA4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CA4 (GFP-tagged) - Human carbonic anhydrase IV (CA4)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human carbonic anhydrase IV (CA4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human carbonic anhydrase IV (CA4), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, CA4 (mGFP-tagged) - Human carbonic anhydrase IV (CA4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-CA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CA4 antibody: synthetic peptide directed towards the middle region of human CA4. Synthetic peptide located within the following region: DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF |
Rabbit Polyclonal Anti-CA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CA4 antibody: synthetic peptide directed towards the C terminal of human CA4. Synthetic peptide located within the following region: AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG |
Transient overexpression lysate of carbonic anhydrase IV (CA4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human carbonic anhydrase IV (CA4), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CA4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CA4 MS Standard C13 and N15-labeled recombinant protein (NP_000708)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CA4 (untagged)-Human carbonic anhydrase IV (CA4)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Anti-CA4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 19-284 amino acids of Human Carbonic anhydrase 4 |
Transient overexpression of CA4 (NM_000717) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human carbonic anhydrase IV (CA4)
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human carbonic anhydrase IV (CA4)
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human carbonic anhydrase IV (CA4)
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human carbonic anhydrase IV (CA4)
| Tag | C-His |
| Expression Host | E. coli |
Transient overexpression of CA4 (NM_000717) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CA4 (NM_000717) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CA4
Pathways
- Nitrogen metabolism