Germany
Japan
United Kingdom
China
POLL (Myc-DDK-tagged)-Human polymerase (DNA directed), lambda (POLL), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
POLL (Myc-DDK-tagged)-Human polymerase (DNA directed), lambda (POLL), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human polymerase (DNA directed), lambda (POLL)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
POLL (Myc-DDK-tagged)-Human polymerase (DNA directed), lambda (POLL), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human polymerase (DNA directed), lambda (POLL), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
6 Weeks
Lenti ORF particles, POLL (Myc-DDK tagged) - Human polymerase (DNA directed), lambda (POLL), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human polymerase (DNA directed), lambda (POLL), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
6 Weeks
Lenti ORF particles, POLL (mGFP-tagged) - Human polymerase (DNA directed), lambda (POLL), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human polymerase (DNA directed), lambda (POLL), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, POLL (Myc-DDK tagged) - Human polymerase (DNA directed), lambda (POLL), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human polymerase (DNA directed), lambda (POLL), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, POLL (mGFP-tagged) - Human polymerase (DNA directed), lambda (POLL), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of POLL (Myc-DDK-tagged)-Human polymerase (DNA directed), lambda (POLL), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
6 Weeks
Lenti ORF particles, POLL (Myc-DDK-tagged)-Human polymerase (DNA directed), lambda (POLL), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of POLL (mGFP-tagged)-Human polymerase (DNA directed), lambda (POLL), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
6 Weeks
Lenti ORF particles, POLL (mGFP-tagged)-Human polymerase (DNA directed), lambda (POLL), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
POLL (GFP-tagged) - Human polymerase (DNA directed), lambda (POLL), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
POLL (GFP-tagged) - Human polymerase (DNA directed), lambda (POLL), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
POLL (GFP-tagged) - Human polymerase (DNA directed), lambda (POLL), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
POLL (untagged)-Human polymerase (DNA directed), lambda (POLL), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
POLL (untagged)-Human polymerase (DNA directed) lambda (POLL) transcript variant 1
| Vector | PCMV6-Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal DNA Polymerase lambda antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DNA Polymerase ?. |
POLL HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 396.00
In Stock
Transient overexpression lysate of polymerase (DNA directed), lambda (POLL), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DNA Polymerase lambda (POLL) (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 546~575 amino acids from the C-terminal region of human DNA polymerase lambda. |
Transient overexpression lysate of polymerase (DNA directed), lambda (POLL)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Goat Anti-POLL / BETA-N Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-LGLPYREPAERDW, from the C Terminus of the protein sequence according to NP_037406.1. |
Rabbit Polyclonal Anti-POLL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLL antibody is: synthetic peptide directed towards the middle region of Human POLL. Synthetic peptide located within the following region: DVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGV |
Rabbit Polyclonal Anti-POLL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLL antibody: synthetic peptide directed towards the middle region of human POLL. Synthetic peptide located within the following region: SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW |
POLL (1-300, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
POLL (1-300, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
USD 121.00
2 Weeks
POLL HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
POLL MS Standard C13 and N15-labeled recombinant protein (NP_037406)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
POLL (untagged)-Human polymerase (DNA directed) lambda (POLL) transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of POLL (NM_013274) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of POLL (NM_001174085) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of POLL (NM_001174084) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of POLL (NM_013274) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of POLL (NM_013274) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of POLL (NM_001174085) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of POLL (NM_001174085) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of POLL (NM_001174084) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of POLL (NM_001174084) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- POLL
Pathways
- Non-homologous end-joining