Products

cDNA Clones (7)
Proteins (6)
Antibodies (1)
Jump to Filters
View as table Download
GCAP2 (GUCA1B) (NM_002098) Human Tagged ORF Clone
RC220183

USD 420.00

In Stock

GUCA1B (Myc-DDK-tagged)-Human guanylate cyclase activator 1B (retina) (GUCA1B)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GCAP2 (GUCA1B) (NM_002098) Human Tagged ORF Clone
RC220183L3

USD 620.00

3 Weeks

Lenti ORF clone of Human guanylate cyclase activator 1B (retina) (GUCA1B), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GCAP2 (GUCA1B) (NM_002098) Human Tagged ORF Clone
RC220183L4

USD 620.00

3 Weeks

Lenti ORF clone of Human guanylate cyclase activator 1B (retina) (GUCA1B), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GCAP2 (GUCA1B) (NM_002098) Human Tagged ORF Clone
RG220183

USD 460.00

3 Weeks

GUCA1B (GFP-tagged) - Human guanylate cyclase activator 1B (retina) (GUCA1B)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GCAP2 (GUCA1B) (NM_002098) Human Untagged Clone
SC303119

USD 420.00

In Stock

GUCA1B (untagged)-Human guanylate cyclase activator 1B (retina) (GUCA1B)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GCAP2 (GUCA1B) (NM_002098) Human Recombinant Protein
TP760676

USD 215.00

In Stock

Purified recombinant protein of Human guanylate cyclase activator 1B (retina) (GUCA1B), with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
GCAP2 (GUCA1B) Rabbit Polyclonal Antibody
TA342731

USD 375.00

5 Days

Rabbit Polyclonal Anti-GUCA1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GUCA1B antibody: synthetic peptide directed towards the N terminal of human GUCA1B. Synthetic peptide located within the following region: SGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNGDNTIDFLEYVAALN
GCAP2 (GUCA1B) (NM_002098) Human Over-expression Lysate
LC419534

USD 121.00

2 Weeks

GUCA1B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GCAP2 (GUCA1B) (NM_002098) Human Over-expression Lysate
LY419534

USD 396.00

5 Days

Transient overexpression lysate of guanylate cyclase activator 1B (retina) (GUCA1B)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GCAP2 (GUCA1B) ICC Control Block
TB420183

USD 1,070.00

4 Weeks

Transient overexpression of GUCA1B (NM_002098) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GCAP2 (GUCA1B) Cytosection
TS420183

USD 225.00

4 Weeks

Transient overexpression of GUCA1B (NM_002098) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GCAP2 (GUCA1B) Cytosection
TS420183P5

USD 889.00

4 Weeks

Transient overexpression of GUCA1B (NM_002098) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack