Products

cDNA Clones (7)
Proteins (3)
Antibodies (2)
Jump to Filters
View as table Download
OR13G1 (NM_001005487) Human Tagged ORF Clone
RC211369

USD 420.00

In Stock

OR13G1 (Myc-DDK-tagged)-Human olfactory receptor, family 13, subfamily G, member 1 (OR13G1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
OR13G1 (NM_001005487) Human Tagged ORF Clone
RC211369L3

USD 620.00

3 Weeks

Lenti ORF clone of Human olfactory receptor, family 13, subfamily G, member 1 (OR13G1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OR13G1 (NM_001005487) Human Tagged ORF Clone Lentiviral Particle
RC211369L3V

USD 820.00

6 Weeks

Lenti ORF particles, OR13G1 (Myc-DDK tagged) - Human olfactory receptor, family 13, subfamily G, member 1 (OR13G1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OR13G1 (NM_001005487) Human Tagged ORF Clone
RC211369L4

USD 620.00

3 Weeks

Lenti ORF clone of Human olfactory receptor, family 13, subfamily G, member 1 (OR13G1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OR13G1 (NM_001005487) Human Tagged ORF Clone Lentiviral Particle
RC211369L4V

USD 820.00

6 Weeks

Lenti ORF particles, OR13G1 (mGFP-tagged) - Human olfactory receptor, family 13, subfamily G, member 1 (OR13G1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OR13G1 (NM_001005487) Human Tagged ORF Clone
RG211369

USD 460.00

3 Weeks

OR13G1 (GFP-tagged) - Human olfactory receptor, family 13, subfamily G, member 1 (OR13G1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OR13G1 Rabbit Polyclonal Antibody
TA316472

USD 345.00

In Stock

Rabbit polyclonal anti-OR13G1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR13G1.
OR13G1 Rabbit Polyclonal Antibody
TA331344

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR13G1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR13G1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR13G1. Synthetic peptide located within the following region: STCSSHLTVVTLYYSPVIYTYIRPASSYTFERDKVVAALYTLVTPTLNPM
OR13G1 (NM_001005487) Human Untagged Clone
SC300971

USD 660.00

3 Weeks

OR13G1 (untagged)-Human olfactory receptor, family 13, subfamily G, member 1 (OR13G1)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
OR13G1 ICC Control Block
TB411369

USD 1,070.00

4 Weeks

Transient overexpression of OR13G1 (NM_001005487) in HEK293T cells paraffin embedded controls for ICC/IHC staining

OR13G1 Cytosection
TS411369

USD 225.00

4 Weeks

Transient overexpression of OR13G1 (NM_001005487) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

OR13G1 Cytosection
TS411369P5

USD 889.00

4 Weeks

Transient overexpression of OR13G1 (NM_001005487) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack