Products

cDNA Clones (22)
Proteins (12)
Antibodies (3)
Jump to Filters
View as table Download
REC8 (NM_005132) Human Tagged ORF Clone
RC200132

USD 98.00

USD 560.00

In Stock

REC8 (Myc-DDK-tagged)-Human REC8 homolog (yeast) (REC8), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
REC8 (NM_001048205) Human Tagged ORF Clone
RC219012

USD 420.00

In Stock

REC8 (Myc-DDK-tagged)-Human REC8 homolog (yeast) (REC8), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
REC8 (NM_005132) Human Tagged ORF Clone Lentiviral Particle
RC200132L1V

USD 1,020.00

2 Weeks

Lenti ORF particles, REC8 (Myc-DDK tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
REC8 (NM_005132) Human Tagged ORF Clone Lentiviral Particle
RC200132L2V

USD 1,020.00

5 Weeks

Lenti ORF particles, REC8 (mGFP-tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
REC8 (NM_001048205) Human Tagged ORF Clone Lentiviral Particle
RC219012L1V

USD 820.00

3 Weeks

Lenti ORF particles, REC8 (Myc-DDK tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
REC8 (NM_001048205) Human Tagged ORF Clone Lentiviral Particle
RC219012L2V

USD 820.00

6 Weeks

Lenti ORF particles, REC8 (mGFP-tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
REC8 (NM_001048205) Human Tagged ORF Clone
RG219012

USD 460.00

In Stock

REC8 (GFP-tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
REC8 (NM_005132) Human Tagged Lenti ORF Clone
RC200132L3

USD 768.00

3 Weeks

Lenti ORF clone of Human REC8 homolog (yeast) (REC8), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
REC8 (NM_005132) Human Tagged ORF Clone Lentiviral Particle
RC200132L3V

USD 1,020.00

5 Weeks

Lenti ORF particles, REC8 (Myc-DDK tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
REC8 (NM_005132) Human Tagged Lenti ORF Clone
RC200132L4

USD 768.00

3 Weeks

Lenti ORF clone of Human REC8 homolog (yeast) (REC8), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
REC8 (NM_005132) Human Tagged ORF Clone Lentiviral Particle
RC200132L4V

USD 1,020.00

5 Weeks

Lenti ORF particles, REC8 (mGFP-tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
REC8 (NM_001048205) Human Tagged ORF Clone
RC219012L3

USD 620.00

3 Weeks

Lenti ORF clone of Human REC8 homolog (yeast) (REC8), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
REC8 (NM_001048205) Human Tagged ORF Clone Lentiviral Particle
RC219012L3V

USD 820.00

5 Weeks

Lenti ORF particles, REC8 (Myc-DDK tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
REC8 (NM_001048205) Human Tagged ORF Clone
RC219012L4

USD 620.00

3 Weeks

Lenti ORF clone of Human REC8 homolog (yeast) (REC8), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
REC8 (NM_001048205) Human Tagged ORF Clone Lentiviral Particle
RC219012L4V

USD 820.00

7 Weeks

Lenti ORF particles, REC8 (mGFP-tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
REC8 (NM_005132) Human Tagged ORF Clone
RG200132

USD 460.00

3 Weeks

REC8 (GFP-tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
REC8 (NM_001048205) Human Tagged ORF Clone
RC219012L1

USD 768.00

In Stock

Lenti ORF clone of Human REC8 homolog (yeast) (REC8), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
REC8 Rabbit Polyclonal Antibody
TA346502

USD 475.00

5 Days

Rabbit Polyclonal Anti-REC8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-REC8 antibody: synthetic peptide directed towards the N terminal of human REC8. Synthetic peptide located within the following region: QLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPN
REC8 (NM_005132) Human Tagged Lenti ORF Clone
RC200132L1

USD 768.00

In Stock

Lenti ORF clone of Human REC8 homolog (yeast) (REC8), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
REC8 (NM_005132) Human Tagged Lenti ORF Clone
RC200132L2

USD 768.00

3 Weeks

Lenti ORF clone of Human REC8 homolog (yeast) (REC8), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
REC8 (NM_001048205) Human Tagged ORF Clone
RC219012L2

USD 620.00

3 Weeks

Lenti ORF clone of Human REC8 homolog (yeast) (REC8), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
REC8 (NM_005132) Human Untagged Clone
SC321201

USD 760.00

In Stock

REC8 (untagged)-Human REC8 homolog (yeast) (REC8), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
REC8 Rabbit Polyclonal Antibody
TA315000

USD 345.00

In Stock

Rabbit polyclonal anti-REC8 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human REC8.
REC8 (NM_001048205) Human Over-expression Lysate
LC420781

USD 187.00

In Stock

REC8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
REC8 (NM_005132) Human Over-expression Lysate
LY401575

USD 396.00

5 Days

Transient overexpression lysate of REC8 homolog (yeast) (REC8), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
REC8 (NM_001048205) Human Over-expression Lysate
LY420781

USD 605.00

In Stock

Transient overexpression lysate of REC8 homolog (yeast) (REC8), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
REC8 (NM_005132) Human Over-expression Lysate
LC401575

USD 121.00

2 Weeks

REC8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
REC8 (NM_005132) Human Mass Spec Standard
PH300132

USD 2,055.00

3 Weeks

REC8 MS Standard C13 and N15-labeled recombinant protein (NP_005123)

Tag C-Myc/DDK
Expression Host HEK293
REC8 (NM_001048205) Human Untagged Clone
SC315442

USD 760.00

3 Weeks

REC8 (untagged)-Human REC8 homolog (yeast) (REC8), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
REC8 Rabbit Polyclonal Antibody
TA350340

USD 345.00

In Stock

Rabbit Polyclonal Anti-REC8 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human REC8
REC8 (NM_005132) ICC Control Block
TB400132

USD 1,210.00

4 Weeks

Transient overexpression of REC8 (NM_005132) in HEK293T cells paraffin embedded controls for ICC/IHC staining

REC8 (NM_001048205) ICC Control Block
TB419012

USD 1,070.00

4 Weeks

Transient overexpression of REC8 (NM_001048205) in HEK293T cells paraffin embedded controls for ICC/IHC staining

REC8 Cytosection
TS400132

USD 225.00

4 Weeks

Transient overexpression of REC8 (NM_005132) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

REC8 Cytosection
TS400132P5

USD 889.00

4 Weeks

Transient overexpression of REC8 (NM_005132) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

REC8 Cytosection
TS419012

USD 225.00

4 Weeks

Transient overexpression of REC8 (NM_001048205) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

REC8 Cytosection
TS419012P5

USD 889.00

4 Weeks

Transient overexpression of REC8 (NM_001048205) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack