Products

cDNA Clones (37)
Proteins (13)
RNAi (12)
Gene Expression (7)
Antibodies (6)
Jump to Filters
View as table Download
REC8 (NM_005132) Human Tagged ORF Clone
RC200132

USD 98.00

USD 560.00

In Stock

REC8 (Myc-DDK-tagged)-Human REC8 homolog (yeast) (REC8), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
REC8 (NM_001048205) Human Tagged ORF Clone
RC219012

USD 420.00

In Stock

REC8 (Myc-DDK-tagged)-Human REC8 homolog (yeast) (REC8), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Rec8 (NM_020002) Mouse Tagged ORF Clone
MR209218

USD 620.00

In Stock

Rec8 (Myc-DDK-tagged) - Mouse REC8 homolog (yeast) (Rec8)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
REC8 (NM_005132) Human Tagged ORF Clone Lentiviral Particle
RC200132L1V

USD 1,020.00

2 Weeks

Lenti ORF particles, REC8 (Myc-DDK tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
REC8 (NM_005132) Human Tagged ORF Clone Lentiviral Particle
RC200132L2V

USD 1,020.00

5 Weeks

Lenti ORF particles, REC8 (mGFP-tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
REC8 (NM_001048205) Human Tagged ORF Clone Lentiviral Particle
RC219012L1V

USD 820.00

3 Weeks

Lenti ORF particles, REC8 (Myc-DDK tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
REC8 (NM_001048205) Human Tagged ORF Clone Lentiviral Particle
RC219012L2V

USD 820.00

6 Weeks

Lenti ORF particles, REC8 (mGFP-tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Rec8 (NM_020002) Mouse Tagged ORF Clone
MG209218

USD 680.00

In Stock

Rec8 (GFP-tagged) - Mouse REC8-like 1 (yeast) (Rec8L1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
REC8 (NM_001048205) Human Tagged ORF Clone
RG219012

USD 460.00

In Stock

REC8 (GFP-tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
REC8 Human Gene Knockout Kit (CRISPR)
KN400132

USD 1,290.00

2 Weeks

REC8 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN400132 is the updated version of KN200132.
Rec8 Mouse Gene Knockout Kit (CRISPR)
KN514637

USD 1,290.00

2 Weeks

Rec8 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN514637 is the updated version of KN314637.
Rec8 (NM_020002) Mouse Tagged ORF Clone
MR209218L3

USD 820.00

3 Weeks

Lenti ORF clone of Rec8 (Myc-DDK-tagged) - Mouse REC8 homolog (yeast) (Rec8)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rec8 (NM_020002) Mouse Tagged ORF Clone
MR209218L4

USD 820.00

3 Weeks

Lenti ORF clone of Rec8 (mGFP-tagged) - Mouse REC8 homolog (yeast) (Rec8)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
REC8 (NM_005132) Human Tagged Lenti ORF Clone
RC200132L3

USD 768.00

3 Weeks

Lenti ORF clone of Human REC8 homolog (yeast) (REC8), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
REC8 (NM_005132) Human Tagged ORF Clone Lentiviral Particle
RC200132L3V

USD 1,020.00

5 Weeks

Lenti ORF particles, REC8 (Myc-DDK tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
REC8 (NM_005132) Human Tagged Lenti ORF Clone
RC200132L4

USD 768.00

3 Weeks

Lenti ORF clone of Human REC8 homolog (yeast) (REC8), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
REC8 (NM_005132) Human Tagged ORF Clone Lentiviral Particle
RC200132L4V

USD 1,020.00

5 Weeks

Lenti ORF particles, REC8 (mGFP-tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
REC8 (NM_001048205) Human Tagged ORF Clone
RC219012L3

USD 620.00

3 Weeks

Lenti ORF clone of Human REC8 homolog (yeast) (REC8), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
REC8 (NM_001048205) Human Tagged ORF Clone Lentiviral Particle
RC219012L3V

USD 820.00

5 Weeks

Lenti ORF particles, REC8 (Myc-DDK tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
REC8 (NM_001048205) Human Tagged ORF Clone
RC219012L4

USD 620.00

3 Weeks

Lenti ORF clone of Human REC8 homolog (yeast) (REC8), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
REC8 (NM_001048205) Human Tagged ORF Clone Lentiviral Particle
RC219012L4V

USD 820.00

7 Weeks

Lenti ORF particles, REC8 (mGFP-tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
REC8 (NM_005132) Human Tagged ORF Clone
RG200132

USD 460.00

3 Weeks

REC8 (GFP-tagged) - Human REC8 homolog (yeast) (REC8), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Rec8 (NM_001011916) Rat Tagged ORF Clone
RR215104

USD 790.00

5 Weeks

Rec8 (Myc-DDK-tagged ORF) - Rat REC8 homolog (yeast) (Rec8), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Rec8 (NM_001011916) Rat Tagged ORF Clone
RR215104L3

USD 1,000.00

9 Weeks

Lenti ORF clone of Rec8 (Myc-DDK-tagged ORF) - Rat REC8 homolog (yeast) (Rec8), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Rec8 (NM_001011916) Rat Tagged ORF Clone
RR215104L4

USD 1,090.00

9 Weeks

Lenti ORF clone of Rec8 (mGFP-tagged ORF) - Rat REC8 homolog (yeast) (Rec8), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
REC8 (NM_001048205) Human Tagged ORF Clone
RC219012L1

USD 768.00

In Stock

Lenti ORF clone of Human REC8 homolog (yeast) (REC8), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
REC8 Rabbit Polyclonal Antibody
TA346502

USD 475.00

5 Days

Rabbit Polyclonal Anti-REC8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-REC8 antibody: synthetic peptide directed towards the N terminal of human REC8. Synthetic peptide located within the following region: QLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPN
REC8 (NM_005132) Human Tagged Lenti ORF Clone
RC200132L1

USD 768.00

In Stock

Lenti ORF clone of Human REC8 homolog (yeast) (REC8), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
REC8 (NM_005132) Human Tagged Lenti ORF Clone
RC200132L2

USD 768.00

3 Weeks

Lenti ORF clone of Human REC8 homolog (yeast) (REC8), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
REC8 (NM_001048205) Human Tagged ORF Clone
RC219012L2

USD 620.00

3 Weeks

Lenti ORF clone of Human REC8 homolog (yeast) (REC8), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
REC8 (NM_005132) Human Untagged Clone
SC321201

USD 760.00

In Stock

REC8 (untagged)-Human REC8 homolog (yeast) (REC8), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
REC8 Rabbit Polyclonal Antibody
TA315000

USD 345.00

In Stock

Rabbit polyclonal anti-REC8 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human REC8.
REC8 Human shRNA Plasmid Kit (Locus ID 9985)
TR309883

USD 715.00

In Stock

REC8 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
REC8 (NM_001048205) Human Over-expression Lysate
LC420781

USD 187.00

In Stock

REC8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
REC8 (NM_005132) Human Over-expression Lysate
LY401575

USD 396.00

5 Days

Transient overexpression lysate of REC8 homolog (yeast) (REC8), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
REC8 (NM_001048205) Human Over-expression Lysate
LY420781

USD 605.00

In Stock

Transient overexpression lysate of REC8 homolog (yeast) (REC8), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
REC8 Human siRNA Oligo Duplex (Locus ID 9985)
SR306716

USD 430.00

In Stock

REC8 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Human REC8 activation kit by CRISPRa
GA106758

USD 1,290.00

2 Weeks

REC8 CRISPRa kit - CRISPR gene activation of human REC8 meiotic recombination protein

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Rec8 activation kit by CRISPRa
GA206074

USD 1,290.00

2 Weeks

Rec8 CRISPRa kit - CRISPR gene activation of mouse REC8 meiotic recombination protein

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
REC8 Human qPCR Template Standard (NM_005132)
HK206218

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene REC8

Application Plasmid of exact quantity for transcript copy number calculation
REC8 Human qPCR Primer Pair (NM_005132)
HP228938

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene REC8

REC8 (NM_005132) Human Over-expression Lysate
LC401575

USD 121.00

2 Weeks

REC8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Rec8 (NM_020002) Mouse Untagged Clone
MC219409

USD 790.00

4 Weeks

Rec8 (untagged) - Mouse REC8 homolog (yeast) (Rec8), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Rec8 Mouse qPCR Primer Pair (NM_020002)
MP212513

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Rec8L1

REC8 (NM_005132) Human Mass Spec Standard
PH300132

USD 2,055.00

3 Weeks

REC8 MS Standard C13 and N15-labeled recombinant protein (NP_005123)

Tag C-Myc/DDK
Expression Host HEK293