Products

cDNA Clones (10)
Proteins (5)
Antibodies (1)
Jump to Filters
View as table Download
Speedy protein C (SPDYC) (NM_001008778) Human Tagged ORF Clone Lentiviral Particle
RC223498L3V

USD 820.00

7 Weeks

Lenti ORF particles, SPDYC (Myc-DDK tagged) - Human speedy homolog C (Xenopus laevis) (SPDYC), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Speedy protein C (SPDYC) (NM_001008778) Human Tagged ORF Clone
RG223498

USD 460.00

3 Weeks

SPDYC (GFP-tagged) - Human speedy homolog C (Xenopus laevis) (SPDYC)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Speedy protein C (SPDYC) (NM_001008778) Human Tagged ORF Clone
RC223498L2

USD 620.00

3 Weeks

Lenti ORF clone of Human speedy homolog C (Xenopus laevis) (SPDYC), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Speedy protein C (SPDYC) Rabbit Polyclonal Antibody
TA332276

USD 375.00

5 Days

Rabbit Polyclonal Anti-SPDYC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPDYC Antibody is: synthetic peptide directed towards the N-terminal region of Human SPDYC. Synthetic peptide located within the following region: PISISYEMSDSQDPTTSPVVTTQVELGGCSRQGGGNGFLRFRQHQEVQAF
Speedy protein C (SPDYC) (NM_001008778) Human Over-expression Lysate
LC423375

USD 121.00

2 Weeks

SPDYC HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Speedy protein C (SPDYC) (NM_001008778) Human Untagged Clone
SC301372

USD 660.00

3 Weeks

SPDYC (untagged)-Human speedy homolog C (Xenopus laevis) (SPDYC)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Speedy protein C (SPDYC) (NM_001008778) ICC Control Block
TB423498

USD 1,070.00

4 Weeks

Transient overexpression of SPDYC (NM_001008778) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Speedy protein C (SPDYC) Cytosection
TS423498

USD 225.00

4 Weeks

Transient overexpression of SPDYC (NM_001008778) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Speedy protein C (SPDYC) Cytosection
TS423498P5

USD 889.00

4 Weeks

Transient overexpression of SPDYC (NM_001008778) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack