Products

cDNA Clones (16)
Proteins (12)
Antibodies (2)
Jump to Filters
View as table Download
STAG3 (NM_012447) Human Tagged ORF Clone
RC218189

USD 1,290.00

In Stock

STAG3 (Myc-DDK-tagged)-Human stromal antigen 3 (STAG3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
STAG3 (NM_001282716) Human Tagged ORF Clone
RC240055

USD 1,290.00

In Stock

STAG3 (myc-DDK-tagged) - Human stromal antigen 3 (STAG3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
STAG3 (NM_012447) Human Tagged ORF Clone
RC218189L3

USD 1,490.00

3 Weeks

Lenti-ORF clone of STAG3 (Myc-DDK-tagged)-Human stromal antigen 3 (STAG3)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
STAG3 (NM_012447) Human Tagged ORF Clone
RC218189L4

USD 1,490.00

3 Weeks

Lenti-ORF clone of STAG3 (mGFP-tagged)-Human stromal antigen 3 (STAG3)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
STAG3 (NM_001282718) Human Tagged ORF Clone
RC240016

USD 1,230.00

5 Weeks

STAG3 (myc-DDK-tagged) - Human stromal antigen 3 (STAG3), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
STAG3 (NM_001282717) Human Tagged ORF Clone
RC240057

USD 1,290.00

5 Weeks

STAG3 (myc-DDK-tagged) - Human stromal antigen 3 (STAG3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
STAG3 (NM_012447) Human Tagged ORF Clone
RG218189

USD 1,420.00

3 Weeks

STAG3 (GFP-tagged) - Human stromal antigen 3 (STAG3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
STAG3 (NM_012447) Human Over-expression Lysate
LY415753

USD 605.00

In Stock

Transient overexpression lysate of stromal antigen 3 (STAG3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
STAG3 Rabbit Polyclonal Antibody
TA315100

USD 345.00

In Stock

Rabbit polyclonal anti-STAG3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human STAG3.
STAG3 (NM_012447) Human Over-expression Lysate
LC415753

USD 187.00

In Stock

STAG3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
STAG3 Rabbit Polyclonal Antibody
TA335651

USD 375.00

5 Days

Rabbit Polyclonal Anti-STAG3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STAG3 Antibody: synthetic peptide directed towards the middle region of human STAG3. Synthetic peptide located within the following region: VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAFCELCQS
STAG3 (NM_001282718) Human Tagged ORF Clone
RG240016

USD 1,270.00

2 Weeks

STAG3 (GFP-tagged) - Human stromal antigen 3 (STAG3), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
STAG3 (NM_001282716) Human Tagged ORF Clone
RG240055

USD 1,330.00

2 Weeks

STAG3 (GFP-tagged) - Human stromal antigen 3 (STAG3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
STAG3 (NM_001282717) Human Tagged ORF Clone
RG240057

USD 1,330.00

2 Weeks

STAG3 (GFP-tagged) - Human stromal antigen 3 (STAG3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
STAG3 (NM_012447) Human Untagged Clone
SC303984

USD 1,100.00

3 Weeks

STAG3 (untagged)-Human stromal antigen 3 (STAG3)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
STAG3 (NM_001282718) Human Untagged Clone
SC337910

USD 1,180.00

5 Weeks

STAG3 (untagged) - Human stromal antigen 3 (STAG3), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
STAG3 (NM_001282716) Human Untagged Clone
SC337949

USD 1,240.00

5 Weeks

STAG3 (untagged) - Human stromal antigen 3 (STAG3), transcript variant 2

Vector pCMV6 series
Tag Tag Free
STAG3 (NM_001282717) Human Untagged Clone
SC337951

USD 1,240.00

5 Weeks

STAG3 (untagged) - Human stromal antigen 3 (STAG3), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
STAG3 (NM_012447) ICC Control Block
TB418189

USD 1,940.00

4 Weeks

Transient overexpression of STAG3 (NM_012447) in HEK293T cells paraffin embedded controls for ICC/IHC staining

STAG3 (NM_001282718) ICC Control Block
TB440016

USD 1,880.00

4 Weeks

Transient overexpression of STAG3 (NM_001282718) in HEK293T cells paraffin embedded controls for ICC/IHC staining

STAG3 (NM_001282716) ICC Control Block
TB440055

USD 1,940.00

4 Weeks

Transient overexpression of STAG3 (NM_001282716) in HEK293T cells paraffin embedded controls for ICC/IHC staining

STAG3 (NM_001282717) ICC Control Block
TB440057

USD 1,940.00

4 Weeks

Transient overexpression of STAG3 (NM_001282717) in HEK293T cells paraffin embedded controls for ICC/IHC staining

STAG3 Cytosection
TS418189

USD 225.00

4 Weeks

Transient overexpression of STAG3 (NM_012447) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

STAG3 Cytosection
TS418189P5

USD 889.00

4 Weeks

Transient overexpression of STAG3 (NM_012447) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

STAG3 ICC Control Sections
TS440016P5

USD 889.00

4 Weeks

Transient overexpression of STAG3 (NM_001282718) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

STAG3 Cytosection
TS440055

USD 225.00

4 Weeks

Transient overexpression of STAG3 (NM_001282716) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

STAG3 Cytosection
TS440055P5

USD 889.00

4 Weeks

Transient overexpression of STAG3 (NM_001282716) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

STAG3 ICC Control Sections
TS440057P5

USD 889.00

4 Weeks

Transient overexpression of STAG3 (NM_001282717) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack