Products

Proteins (7)
cDNA Clones (7)
Antibodies (1)
Jump to Filters
View as table Download
ATP6V1C1 (NM_001695) Human Tagged ORF Clone
RC203149

USD 420.00

In Stock

ATP6V1C1 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 (ATP6V1C1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ATP6V1C1 (NM_001695) Human Tagged ORF Clone
RG203149

USD 460.00

In Stock

ATP6V1C1 (GFP-tagged) - Human ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 (ATP6V1C1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ATP6V1C1 (NM_001695) Human Tagged ORF Clone
RC203149L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 (ATP6V1C1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V1C1 (NM_001695) Human Tagged ORF Clone Lentiviral Particle
RC203149L3V

USD 820.00

6 Weeks

Lenti ORF particles, ATP6V1C1 (Myc-DDK tagged) - Human ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 (ATP6V1C1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V1C1 (NM_001695) Human Tagged ORF Clone
RC203149L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 (ATP6V1C1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V1C1 (NM_001695) Human Tagged ORF Clone Lentiviral Particle
RC203149L4V

USD 820.00

6 Weeks

Lenti ORF particles, ATP6V1C1 (mGFP-tagged) - Human ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 (ATP6V1C1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ATP6V1C1 (NM_001695) Human Untagged Clone
SC319707

USD 310.00

In Stock

ATP6V1C1 (untagged)-Human ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 (ATP6V1C1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ATP6V1C1 (NM_001695) Human Over-expression Lysate
LY419795

USD 396.00

In Stock

Transient overexpression lysate of ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 (ATP6V1C1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ATP6V1C1 Rabbit Polyclonal Antibody
TA344278

USD 475.00

5 Days

Rabbit Polyclonal Anti-ATP6V1C1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V1C1 antibody: synthetic peptide directed towards the N terminal of human ATP6V1C1. Synthetic peptide located within the following region: ldafvegvvkkvaqymadvledskdkvqenllangvdlvtyitrfqwdma
ATP6V1C1 (NM_001695) Human Over-expression Lysate
LC419795

USD 121.00

2 Weeks

ATP6V1C1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ATP6V1C1 (NM_001695) Human Mass Spec Standard
PH303149

USD 2,055.00

3 Weeks

ATP6V1C1 MS Standard C13 and N15-labeled recombinant protein (NP_001686)

Tag C-Myc/DDK
Expression Host HEK293
ATP6V1C1 ICC Control Block
TB403149

USD 1,070.00

4 Weeks

Transient overexpression of ATP6V1C1 (NM_001695) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ATP6V1C1 Cytosection
TS403149

USD 225.00

4 Weeks

Transient overexpression of ATP6V1C1 (NM_001695) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ATP6V1C1 Cytosection
TS403149P5

USD 889.00

4 Weeks

Transient overexpression of ATP6V1C1 (NM_001695) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack