Products

cDNA Clones (17)
Proteins (7)
Antibodies (1)
Jump to Filters
View as table Download
Cytochrome b c1 complex subunit 9 (UQCR10) (NM_013387) Human Tagged ORF Clone Lentiviral Particle
RC202816L1V

USD 820.00

3 Weeks

Lenti ORF particles, UQCR10 (Myc-DDK tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Cytochrome b c1 complex subunit 9 (UQCR10) (NM_013387) Human Tagged ORF Clone Lentiviral Particle
RC202816L2V

USD 820.00

6 Weeks

Lenti ORF particles, UQCR10 (mGFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Cytochrome b c1 complex subunit 9 (UQCR10) (NM_001003684) Human Tagged ORF Clone
RG220688

USD 460.00

In Stock

UQCR10 (GFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cytochrome b c1 complex subunit 9 (UQCR10) (NM_013387) Human Tagged ORF Clone
RC202816L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cytochrome b c1 complex subunit 9 (UQCR10) (NM_013387) Human Tagged ORF Clone Lentiviral Particle
RC202816L3V

USD 820.00

5 Weeks

Lenti ORF particles, UQCR10 (Myc-DDK tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cytochrome b c1 complex subunit 9 (UQCR10) (NM_013387) Human Tagged ORF Clone
RC202816L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cytochrome b c1 complex subunit 9 (UQCR10) (NM_013387) Human Tagged ORF Clone Lentiviral Particle
RC202816L4V

USD 820.00

7 Weeks

Lenti ORF particles, UQCR10 (mGFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cytochrome b c1 complex subunit 9 (UQCR10) (NM_001003684) Human Tagged ORF Clone
RC220688

USD 420.00

2 Weeks

UQCR10 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cytochrome b c1 complex subunit 9 (UQCR10) (NM_001003684) Human Tagged ORF Clone
RC220688L3

USD 620.00

3 Weeks

Lenti-ORF clone of UQCR10 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cytochrome b c1 complex subunit 9 (UQCR10) (NM_001003684) Human Tagged ORF Clone Lentiviral Particle
RC220688L3V

USD 820.00

6 Weeks

Lenti ORF particles, UQCR10 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cytochrome b c1 complex subunit 9 (UQCR10) (NM_001003684) Human Tagged ORF Clone
RC220688L4

USD 620.00

3 Weeks

Lenti-ORF clone of UQCR10 (mGFP-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cytochrome b c1 complex subunit 9 (UQCR10) (NM_001003684) Human Tagged ORF Clone Lentiviral Particle
RC220688L4V

USD 820.00

6 Weeks

Lenti ORF particles, UQCR10 (mGFP-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cytochrome b c1 complex subunit 9 (UQCR10) Rabbit Polyclonal Antibody
TA335305

USD 375.00

5 Days

Rabbit Polyclonal Anti-UCRC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Cytochrome b c1 complex subunit 9 (UQCR10) (NM_013387) Human Over-expression Lysate
LY415610

USD 396.00

5 Days

Transient overexpression lysate of ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cytochrome b c1 complex subunit 9 (UQCR10) ICC Control Block
TB420688

USD 1,070.00

4 Weeks

Transient overexpression of UQCR10 (NM_001003684) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cytochrome b c1 complex subunit 9 (UQCR10) Cytosection
TS402816

USD 225.00

4 Weeks

Transient overexpression of UQCR10 (NM_013387) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Cytochrome b c1 complex subunit 9 (UQCR10) Cytosection
TS402816P5

USD 889.00

4 Weeks

Transient overexpression of UQCR10 (NM_013387) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Cytochrome b c1 complex subunit 9 (UQCR10) ICC Control Sections
TS420688P5

USD 889.00

4 Weeks

Transient overexpression of UQCR10 (NM_001003684) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack