USD 98.00
USD 390.00
In Stock
UQCR10 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 98.00
USD 390.00
In Stock
UQCR10 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, UQCR10 (Myc-DDK tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, UQCR10 (mGFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 460.00
In Stock
UQCR10 (GFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 460.00
In Stock
UQCR10 (GFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 620.00
3 Weeks
Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, UQCR10 (Myc-DDK tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 620.00
3 Weeks
Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, UQCR10 (mGFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 420.00
2 Weeks
UQCR10 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 620.00
3 Weeks
Lenti-ORF clone of UQCR10 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, UQCR10 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 620.00
3 Weeks
Lenti-ORF clone of UQCR10 (mGFP-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, UQCR10 (mGFP-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-UCRC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
USD 620.00
3 Weeks
Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 310.00
In Stock
UQCR10 (untagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 121.00
2 Weeks
UQCR10 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 396.00
5 Days
Transient overexpression lysate of ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 420.00
2 Weeks
UQCR10 (untagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), nuclear gene encoding mitochondrial protein, transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
USD 1,040.00
4 Weeks
Transient overexpression of UQCR10 (NM_013387) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of UQCR10 (NM_001003684) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of UQCR10 (NM_013387) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of UQCR10 (NM_013387) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of UQCR10 (NM_001003684) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack