Products

Proteins (11)
cDNA Clones (11)
Antibodies (5)
Jump to Filters
View as table Download
Apolipoprotein A II (APOA2) (NM_001643) Human Recombinant Protein
TP721104

USD 330.00

3 Weeks

Purified recombinant protein of Human apolipoprotein A-II (APOA2)

Tag C-His
Expression Host HEK293
Apolipoprotein A II (APOA2) Rabbit Polyclonal Antibody
AP22595PU-N

USD 440.00

2 Weeks

Apolipoprotein A II (APOA2) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Human Apo AII
Apolipoprotein A II (APOA2) (NM_001643) Human Over-expression Lysate
LC400619

USD 121.00

In Stock

APOA2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Apolipoprotein A II (APOA2) Rabbit Polyclonal Antibody
TA335017

USD 375.00

5 Days

Rabbit Polyclonal Anti-APOA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOA2 antibody: synthetic peptide directed towards the N terminal of human APOA2. Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME
Apolipoprotein A II (APOA2) (NM_001643) Human Recombinant Protein
TP761148

USD 215.00

In Stock

Purified recombinant protein of Human apolipoprotein A-II (APOA2), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
Apolipoprotein A II (APOA2) Rabbit Polyclonal Antibody
TA328111

USD 450.00

5 Days

Rabbit polyclonal anti-APOA2 antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This APOA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-56 amino acids from the Central region of human APOA2.
Apolipoprotein A II / Apo AII Human Protein
BA677

USD 260.00

5 Days

Apolipoprotein A II / Apo AII human protein, 0.5 mg

Protein Source Plasma
Apolipoprotein A II (APOA2) ICC Control Block
TB402723

USD 1,040.00

4 Weeks

Transient overexpression of APOA2 (NM_001643) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Apolipoprotein A II (APOA2) (NM_001643) Human Recombinant Protein
TP721104L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human apolipoprotein A-II (APOA2)

Tag C-His
Expression Host HEK293
Apolipoprotein A II (APOA2) (NM_001643) Human Recombinant Protein
TP721104M

USD 760.00

3 Weeks

Purified recombinant protein of Human apolipoprotein A-II (APOA2)

Tag C-His
Expression Host HEK293
Apolipoprotein A II (APOA2) (NM_001643) Human Recombinant Protein
TP721104XL

USD 2,800.00

3 Weeks

Purified recombinant protein of Human apolipoprotein A-II (APOA2)

Tag C-His
Expression Host HEK293
Apolipoprotein A II (APOA2) Cytosection
TS402723

USD 225.00

4 Weeks

Transient overexpression of APOA2 (NM_001643) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Apolipoprotein A II (APOA2) Cytosection
TS402723P5

USD 889.00

4 Weeks

Transient overexpression of APOA2 (NM_001643) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack