Products

cDNA Clones (37)
Proteins (21)
Antibodies (2)
Jump to Filters
View as table Download
UBE2J2 (NM_194315) Human Tagged ORF Clone
RC217659

USD 420.00

In Stock

UBE2J2 (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
UBE2J2 (NM_194315) Human Tagged ORF Clone Lentiviral Particle
RC217659L1V

USD 820.00

3 Weeks

Lenti ORF particles, UBE2J2 (Myc-DDK tagged) - Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
UBE2J2 (NM_194315) Human Tagged ORF Clone Lentiviral Particle
RC217659L2V

USD 820.00

6 Weeks

Lenti ORF particles, UBE2J2 (mGFP-tagged) - Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
UBE2J2 (NM_194458) Human Tagged ORF Clone Lentiviral Particle
RC219392L1V

USD 820.00

6 Weeks

Lenti ORF particles, UBE2J2 (Myc-DDK tagged) - Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
UBE2J2 (NM_194458) Human Tagged ORF Clone Lentiviral Particle
RC219392L2V

USD 820.00

6 Weeks

Lenti ORF particles, UBE2J2 (mGFP-tagged) - Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
UBE2J2 (NM_194458) Human Tagged ORF Clone
RC219392

USD 420.00

In Stock

UBE2J2 (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
UBE2J2 (NM_194457) Human Tagged ORF Clone
RC210527

USD 98.00

USD 390.00

In Stock

UBE2J2 (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
UBE2J2 (NM_194458) Human Tagged ORF Clone
RG219392

USD 460.00

In Stock

UBE2J2 (GFP-tagged) - Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UBE2J2 (NM_194457) Human Tagged ORF Clone
RC210527L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UBE2J2 (NM_194457) Human Tagged ORF Clone Lentiviral Particle
RC210527L3V

USD 820.00

6 Weeks

Lenti ORF particles, UBE2J2 (Myc-DDK tagged) - Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UBE2J2 (NM_194457) Human Tagged ORF Clone
RC210527L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UBE2J2 (NM_194457) Human Tagged ORF Clone Lentiviral Particle
RC210527L4V

USD 820.00

6 Weeks

Lenti ORF particles, UBE2J2 (mGFP-tagged) - Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UBE2J2 (NM_194315) Human Tagged ORF Clone
RC217659L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UBE2J2 (NM_194315) Human Tagged ORF Clone Lentiviral Particle
RC217659L3V

USD 820.00

7 Weeks

Lenti ORF particles, UBE2J2 (Myc-DDK tagged) - Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UBE2J2 (NM_194315) Human Tagged ORF Clone
RC217659L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UBE2J2 (NM_194315) Human Tagged ORF Clone Lentiviral Particle
RC217659L4V

USD 820.00

7 Weeks

Lenti ORF particles, UBE2J2 (mGFP-tagged) - Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UBE2J2 (NM_194458) Human Tagged ORF Clone
RC219392L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UBE2J2 (NM_194458) Human Tagged ORF Clone Lentiviral Particle
RC219392L3V

USD 820.00

6 Weeks

Lenti ORF particles, UBE2J2 (Myc-DDK tagged) - Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UBE2J2 (NM_194458) Human Tagged ORF Clone
RC219392L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UBE2J2 (NM_194458) Human Tagged ORF Clone Lentiviral Particle
RC219392L4V

USD 820.00

6 Weeks

Lenti ORF particles, UBE2J2 (mGFP-tagged) - Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UBE2J2 (NM_058167) Human Tagged ORF Clone
RC223522

USD 420.00

3 Weeks

UBE2J2 (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
UBE2J2 (NM_058167) Human Tagged ORF Clone
RC223522L3

USD 620.00

3 Weeks

Lenti-ORF clone of UBE2J2 (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UBE2J2 (NM_058167) Human Tagged ORF Clone Lentiviral Particle
RC223522L3V

USD 820.00

6 Weeks

Lenti ORF particles, UBE2J2 (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UBE2J2 (NM_058167) Human Tagged ORF Clone
RC223522L4

USD 620.00

3 Weeks

Lenti-ORF clone of UBE2J2 (mGFP-tagged)-Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UBE2J2 (NM_058167) Human Tagged ORF Clone Lentiviral Particle
RC223522L4V

USD 820.00

6 Weeks

Lenti ORF particles, UBE2J2 (mGFP-tagged)-Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UBE2J2 (NM_194457) Human Tagged ORF Clone
RG210527

USD 460.00

3 Weeks

UBE2J2 (GFP-tagged) - Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UBE2J2 (NM_194315) Human Tagged ORF Clone
RG217659

USD 460.00

3 Weeks

UBE2J2 (GFP-tagged) - Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UBE2J2 (NM_058167) Human Tagged ORF Clone
RG223522

USD 460.00

4 Weeks

UBE2J2 (GFP-tagged) - Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UBE2J2 (NM_194315) Human Tagged ORF Clone
RC217659L1

USD 768.00

In Stock

Lenti ORF clone of Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
UBE2J2 (NM_194315) Human Tagged ORF Clone
RC217659L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
UBE2J2 (NM_194458) Human Tagged ORF Clone
RC219392L1

USD 620.00

3 Weeks

Lenti ORF clone of Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
UBE2J2 (NM_194458) Human Tagged ORF Clone
RC219392L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
UBE2J2 (AF296658) Human Untagged Clone
SC106467

USD 660.00

In Stock

(untagged)-Human ubiquitin conjugating enzyme 6 mRNA, complete cds

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
UBE2J2 (NM_194457) Human Untagged Clone
SC125023

USD 420.00

In Stock

UBE2J2 (untagged)-Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 4

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
UBE2J2 Rabbit Polyclonal Antibody
TA330495

USD 310.00

5 Days

Rabbit Polyclonal Anti-UBE2J2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBE2J2 antibody: synthetic peptide directed towards the C terminal of human UBE2J2. Synthetic peptide located within the following region: GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK
UBE2J2 (NM_194315) Human Over-expression Lysate
LY405165

USD 396.00

5 Days

Transient overexpression lysate of ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) (UBE2J2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

LY405165 is the same product as LY430678.
UBE2J2 Rabbit Polyclonal Antibody
TA319512

USD 530.00

5 Days

Rabbit polyclonal Ubiquitin-Conjugating Enzyme E2 J2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of the human Ube2j2 protein.
UBE2J2 (1-226, His-tag) Human Protein
AR50432PU-N

USD 845.00

2 Weeks

UBE2J2 (1-226, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
UBE2J2 (1-226, His-tag) Human Protein
AR50432PU-S

USD 330.00

2 Weeks

UBE2J2 (1-226, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
UBE2J2 (NM_194315) Human Over-expression Lysate
LC405165

USD 121.00

2 Weeks

UBE2J2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
UBE2J2 (NM_194315) Human Over-expression Lysate
LC430678

USD 121.00

2 Weeks

UBE2J2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
UBE2J2 (NM_194315) Human Over-expression Lysate
LY430678

USD 396.00

5 Days

Transient overexpression lysate of ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) (UBE2J2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

UBE2J2 (NM_194315) Human Untagged Clone
SC309351

USD 660.00

3 Weeks

UBE2J2 (untagged)-Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
UBE2J2 (NM_194458) Human Untagged Clone
SC309702

USD 420.00

3 Weeks

UBE2J2 (untagged)-Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
UBE2J2 (NM_058167) Human Untagged Clone
SC310589

USD 420.00

4 Weeks

UBE2J2 (untagged)-Human ubiquitin-conjugating enzyme E2, J2 (UBE2J2), transcript variant 2

Vector pCMV6 series
Tag Tag Free
UBE2J2 (NM_194457) ICC Control Block
TB410527

USD 1,040.00

4 Weeks

Transient overexpression of UBE2J2 (NM_194457) in HEK293T cells paraffin embedded controls for ICC/IHC staining

UBE2J2 (NM_194315) ICC Control Block
TB417659

USD 1,070.00

4 Weeks

Transient overexpression of UBE2J2 (NM_194315) in HEK293T cells paraffin embedded controls for ICC/IHC staining

UBE2J2 (NM_194458) ICC Control Block
TB419392

USD 1,070.00

4 Weeks

Transient overexpression of UBE2J2 (NM_194458) in HEK293T cells paraffin embedded controls for ICC/IHC staining

UBE2J2 (NM_058167) ICC Control Block
TB423522

USD 1,070.00

4 Weeks

Transient overexpression of UBE2J2 (NM_058167) in HEK293T cells paraffin embedded controls for ICC/IHC staining

UBE2J2 (NM_058167) Human Recombinant Protein
TP720531

USD 330.00

3 Weeks

Recombinant protein of human ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) (UBE2J2), transcript variant 2

Tag N-GST
Expression Host E. coli