Products

cDNA Clones (14)
Proteins (9)
Antibodies (3)
Jump to Filters
View as table Download
E2F3 (NM_001949) Human Tagged ORF Clone
RC222471

USD 420.00

In Stock

E2F3 (Myc-DDK-tagged)-Human E2F transcription factor 3 (E2F3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
E2F3 (NM_001949) Human Tagged ORF Clone Lentiviral Particle
RC222471L2V

USD 820.00

6 Weeks

Lenti ORF particles, E2F3 (mGFP-tagged) - Human E2F transcription factor 3 (E2F3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
E2F3 (NM_001949) Human Tagged ORF Clone
RG222471

USD 460.00

In Stock

E2F3 (GFP-tagged) - Human E2F transcription factor 3 (E2F3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
E2F3 (NM_001243076) Human Tagged ORF Clone
RC233799

USD 420.00

In Stock

E2F3 (Myc-DDK tagged) - Homo sapiens E2F transcription factor 3 (E2F3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
E2F3 (NM_001949) Human Tagged ORF Clone
RC222471L4

USD 620.00

In Stock

Lenti ORF clone of Human E2F transcription factor 3 (E2F3), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
E2F3 (NM_001949) Human Tagged ORF Clone Lentiviral Particle
RC222471L4V

USD 820.00

3 Weeks

Lenti ORF particles, E2F3 (mGFP-tagged) - Human E2F transcription factor 3 (E2F3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
E2F3 (NM_001243076) Human Tagged ORF Clone
RG233799

USD 460.00

3 Weeks

E2F3 (GFP-tagged) - Homo sapiens E2F transcription factor 3 (E2F3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
E2F3 (NM_001949) Human Untagged Clone
SC110876

USD 780.00

In Stock

E2F3 (untagged)-Human E2F transcription factor 3 (E2F3)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
E2F3 (NM_001949) Human Recombinant Protein
TP760363

USD 215.00

In Stock

Purified recombinant protein of Human E2F transcription factor 3 (E2F3), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
E2F3 Rabbit Polyclonal Antibody
TA349084

USD 484.00

5 Days

Rabbit Polyclonal Anti-E2F3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen E2F3 antibody was raised against a 15 amino acid peptide near the center of human E2F3.
E2F3 (NM_001949) Human Tagged ORF Clone
RC222471L1

USD 768.00

In Stock

Lenti ORF clone of Human E2F transcription factor 3 (E2F3), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
E2F3 (NM_001949) Human Over-expression Lysate
LY400716

USD 605.00

In Stock

Transient overexpression lysate of E2F transcription factor 3 (E2F3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
E2F3 (NM_001949) Human Over-expression Lysate
LC400716

USD 187.00

In Stock

E2F3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
E2F3 (NM_001949) Human Tagged ORF Clone
RC222471L2

USD 620.00

3 Weeks

Lenti ORF clone of Human E2F transcription factor 3 (E2F3), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
E2F3 Goat Polyclonal Antibody
TA321026

USD 375.00

5 Days

Goat Polyclonal Anti-E2F3 (mouse) Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen C Terminus of NP_034223.1 (DLEKLPLVEDFMCS)
E2F3 Rabbit Polyclonal Antibody
TA335211

USD 375.00

5 Days

Rabbit Polyclonal Anti-E2F3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F3 antibody: synthetic peptide directed towards the C terminal of human E2F3. Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK
E2F3 (NM_001243076) Human Untagged Clone
SC331943

USD 340.00

5 Weeks

E2F3 (untagged) - Homo sapiens E2F transcription factor 3 (E2F3), transcript variant 2

Vector pCMV6 series
Tag Tag Free
E2F3 ICC Control Block
TB422471

USD 1,070.00

4 Weeks

Transient overexpression of E2F3 (NM_001949) in HEK293T cells paraffin embedded controls for ICC/IHC staining

E2F3 ICC Control Block
TB433799

USD 1,070.00

4 Weeks

Transient overexpression of E2F3 (NM_001243076) in HEK293T cells paraffin embedded controls for ICC/IHC staining

E2F3 Cytosection
TS422471

USD 225.00

4 Weeks

Transient overexpression of E2F3 (NM_001949) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

E2F3 Cytosection
TS422471P5

USD 889.00

4 Weeks

Transient overexpression of E2F3 (NM_001949) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

E2F3 Cytosection
TS433799

USD 225.00

4 Weeks

Transient overexpression of E2F3 (NM_001243076) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

E2F3 Cytosection
TS433799P5

USD 889.00

4 Weeks

Transient overexpression of E2F3 (NM_001243076) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack