Products

View as table Download

FZD7 (Myc-DDK-tagged)-Human frizzled family receptor 7 (FZD7)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

FZD7 (GFP-tagged) - Human frizzled family receptor 7 (FZD7)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

FZD7 (untagged)-Human frizzled homolog 7 (Drosophila) (cDNA clone MGC:20119 IMAGE:4549389), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-FZD7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV

FZD7 (untagged)-Human frizzled family receptor 7 (FZD7)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human frizzled family receptor 7 (FZD7), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Goat Polyclonal Antibody against FZD7

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RFYHRLSHSSKGET, from the C Terminus of the protein sequence according to NP_003498.1.

Transient overexpression of FZD7 (NM_003507) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of FZD7 (NM_003507) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of FZD7 (NM_003507) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack