Germany
Japan
United Kingdom
China
LAMC3 (Myc-DDK-tagged)-Human laminin, gamma 3 (LAMC3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF clone of Human laminin, gamma 3 (LAMC3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 2,050.00
6 Weeks
Lenti ORF particles, LAMC3 (Myc-DDK tagged) - Human laminin, gamma 3 (LAMC3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human laminin, gamma 3 (LAMC3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 2,050.00
6 Weeks
Lenti ORF particles, LAMC3 (mGFP-tagged) - Human laminin, gamma 3 (LAMC3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
LAMC3 (GFP-tagged) - Human laminin, gamma 3 (LAMC3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
LAMC3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-LAMC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAMC3 antibody is: synthetic peptide directed towards the C-terminal region of Human LAMC3. Synthetic peptide located within the following region: ERMLGNAAPLSSSAKKKGREAEVLAKDSAKLAKALLRERKQAHRRASRLT |
Transient overexpression lysate of laminin, gamma 3 (LAMC3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
LAMC3 MS Standard C13 and N15-labeled recombinant protein (NP_006050)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
LAMC3 (untagged)-Human laminin, gamma 3 (LAMC3)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of LAMC3 (NM_006059) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LAMC3 (NM_006059) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LAMC3 (NM_006059) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- LAMC3
Pathways
- Pathways in cancer