PIK3R3 (Myc-DDK-tagged)-Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PIK3R3 (Myc-DDK-tagged)-Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PIK3R3 (Myc-DDK-tagged)-Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
4 Weeks
Lenti ORF particles, PIK3R3 (Myc-DDK tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, PIK3R3 (mGFP-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
4 Weeks
Lenti ORF particles, PIK3R3 (Myc-DDK tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, PIK3R3 (mGFP-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PIK3R3 (GFP-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PIK3R3 (Myc-DDK tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PIK3R3 (mGFP-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PIK3R3 (Myc-DDK tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PIK3R3 (mGFP-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PIK3R3 (myc-DDK-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PIK3R3 (myc-DDK-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PIK3R3 (GFP-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal antibody to PIK3R3 (phosphoinositide-3-kinase, regulatory subunit 3 (gamma))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 192 and 427 of PIK3R3 |
Lenti ORF clone of Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 121.00
In Stock
PIK3R3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 121.00
In Stock
PIK3R3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PIK3R3 (untagged)-Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PIK3R3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PIK3R3 antibody is: synthetic peptide directed towards the C-terminal region of Human PIK3R3. Synthetic peptide located within the following region: DAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIK |
Rabbit Polyclonal Anti-PIK3R3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PIK3R3 Antibody: synthetic peptide directed towards the middle region of human PIK3R3. Synthetic peptide located within the following region: EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNE |
USD 396.00
5 Days
Transient overexpression lysate of phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
USD 2,055.00
3 Weeks
PIK3R3 MS Standard C13 and N15-labeled recombinant protein (NP_001107644)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
PIK3R3 (GFP-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PIK3R3 (GFP-tagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PIK3R3 (untagged)-Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PIK3R3 (untagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 5
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PIK3R3 (untagged) - Human phosphoinositide-3-kinase, regulatory subunit 3 (gamma) (PIK3R3), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-PIK3R3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PIK3R3 |
Transient overexpression of PIK3R3 (NM_003629) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PIK3R3 (NM_001114172) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PIK3R3 (NM_001303429) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PIK3R3 (NM_001303428) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PIK3R3 (NM_003629) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PIK3R3 (NM_003629) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PIK3R3 (NM_001114172) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PIK3R3 (NM_001114172) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PIK3R3 (NM_001303429) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PIK3R3 (NM_001303428) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack