RXRG (Myc-DDK-tagged)-Human retinoid X receptor, gamma (RXRG), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RXRG (Myc-DDK-tagged)-Human retinoid X receptor, gamma (RXRG), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human retinoid X receptor, gamma (RXRG), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, RXRG (Myc-DDK tagged) - Human retinoid X receptor, gamma (RXRG), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, RXRG (mGFP-tagged) - Human retinoid X receptor, gamma (RXRG), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
RXRG (GFP-tagged) - Human retinoid X receptor, gamma (RXRG), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human retinoid X receptor, gamma (RXRG), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, RXRG (Myc-DDK tagged) - Human retinoid X receptor, gamma (RXRG), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, RXRG (mGFP-tagged) - Human retinoid X receptor, gamma (RXRG), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
RXRG (Myc-DDK tagged) - Homo sapiens retinoid X receptor, gamma (RXRG), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RXRG (Myc-DDK tagged) - Homo sapiens retinoid X receptor, gamma (RXRG), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RXRG (GFP-tagged) - Homo sapiens retinoid X receptor, gamma (RXRG), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RXRG (GFP-tagged) - Homo sapiens retinoid X receptor, gamma (RXRG), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RXRG (untagged)-Human retinoid X receptor, gamma (RXRG), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human retinoid X receptor, gamma (RXRG), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit polyclonal Retinoid X Receptor gamma antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Retinoid X Receptor ? antibody. |
RXRG (untagged)-Human retinoid X receptor, gamma (RXRG), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-RXRG Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RXRG antibody: synthetic peptide directed towards the C terminal of human RXRG. Synthetic peptide located within the following region: LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT |
Retinoid X Receptor gamma (RXRG) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 150-250 of Human RXRγ. |
Lenti ORF clone of Human retinoid X receptor, gamma (RXRG), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 121.00
In Stock
RXRG HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Goat Polyclonal Antibody against RXR gamma
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RQRSRERAESEAEC, from the internal region of the protein sequence according to NP_008848. |
USD 415.00
5 Days
Mouse Anti-Retinoid X Receptor, g-Isotype Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RXRG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RXRG antibody: synthetic peptide directed towards the N terminal of human RXRG. Synthetic peptide located within the following region: NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH |
Rabbit Polyclonal Anti-RXRG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RXRG antibody: synthetic peptide directed towards the N terminal of human RXRG. Synthetic peptide located within the following region: GSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLP |
USD 396.00
5 Days
Transient overexpression lysate of retinoid X receptor, gamma (RXRG), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
RXRG MS Standard C13 and N15-labeled recombinant protein (NP_008848)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
RXRG (untagged) - Homo sapiens retinoid X receptor, gamma (RXRG), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
RXRG (untagged) - Homo sapiens retinoid X receptor, gamma (RXRG), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of RXRG (NM_006917) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RXRG (NM_001256570) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RXRG (NM_001256571) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RXRG (NM_006917) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RXRG (NM_006917) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RXRG (NM_001256570) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RXRG (NM_001256571) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack