SHH (Myc-DDK-tagged)-Human sonic hedgehog (SHH)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SHH (Myc-DDK-tagged)-Human sonic hedgehog (SHH)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SHH (GFP-tagged) - Human sonic hedgehog (SHH)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 830.00
2 Weeks
Lenti ORF particles, SHH (Myc-DDK tagged) - Human sonic hedgehog (SHH), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 830.00
3 Weeks
Lenti ORF particles, SHH (mGFP-tagged) - Human sonic hedgehog (SHH), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
SHH (untagged)-Human sonic hedgehog (SHH)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 830.00
5 Weeks
Lenti ORF particles, SHH (Myc-DDK tagged) - Human sonic hedgehog (SHH), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human sonic hedgehog (SHH), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 830.00
3 Weeks
Lenti ORF particles, SHH (mGFP-tagged) - Human sonic hedgehog (SHH), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of sonic hedgehog homolog (Drosophila) (SHH)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Sonic hedgehog (SHH) human protein, 25 µg
Expression Host | E. coli |
Sonic hedgehog (SHH) human protein, 5 µg
Expression Host | E. coli |
Mouse Monoclonal Sonic Hedgehog/Shh Antibody (5H4)
Applications | ELISA, FC, IHC, WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal Sonic Hedgehog/Shh Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal portion of the human SHH protein (between residues 1-75) [UniProt Q15465] |
Sonic Hedgehog (SHH) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence near the N-terminal of human SHH |
SHH HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-SHH Antibody
Applications | IHC, WB |
Reactivities | Chicken, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT |
Sonic hedgehog (SHH) (24-197, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
Sonic hedgehog (SHH) (24-197, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Sonic hedgehog (SHH) (24-197, ) human recombinant protein, 0.25 mg
Expression Host | E. coli |
Sonic hedgehog (SHH) (24-197, ) human recombinant protein, 50 µg
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) SHH mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SHH mouse monoclonal antibody, clone OTI10H6 (formerly 10H6)
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
SHH MS Standard C13 and N15-labeled recombinant protein (NP_000184)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-SHH Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 448-462 amino acids of Human sonic hedgehog |
Anti-SHH Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 448-462 amino acids of Human sonic hedgehog |
Anti-SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI3A2 (formerly 3A2), Biotinylated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI3A2 (formerly 3A2), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI10H6 (formerly 10H6)
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
SHH mouse monoclonal antibody, clone 10H6, Biotinylated
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
5 Days
SHH mouse monoclonal antibody, clone 10H6, HRP conjugated
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI10H6 (formerly 10H6)
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Transient overexpression of SHH (NM_000193) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human sonic hedgehog (SHH)
Tag | tag free |
Expression Host | E. coli |
Purified recombinant protein of Human sonic hedgehog (SHH)
Tag | tag free |
Expression Host | E. coli |
Purified recombinant protein of Human sonic hedgehog (SHH)
Tag | tag free |
Expression Host | E. coli |
Purified recombinant protein of Human sonic hedgehog (SHH)
Tag | tag free |
Expression Host | E. coli |
Purified recombinant protein of Human sonic hedgehog (SHH)
Tag | tag free |
Expression Host | E. coli |
Purified recombinant protein of Human sonic hedgehog (SHH)
Tag | tag free |
Expression Host | E. coli |
Purified recombinant protein of Human sonic hedgehog (SHH)
Tag | tag free |
Expression Host | E. coli |
Purified recombinant protein of Human sonic hedgehog (SHH)
Tag | tag free |
Expression Host | E. coli |
Transient overexpression of SHH (NM_000193) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SHH (NM_000193) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack