Products

View as table Download

Rabbit anti-UGT1A1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A1

Rabbit Polyclonal Anti-DCXR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCXR antibody: synthetic peptide directed towards the middle region of human DCXR. Synthetic peptide located within the following region: STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM

Rabbit Polyclonal Anti-RPE Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPE antibody: synthetic peptide directed towards the N terminal of human RPE. Synthetic peptide located within the following region: ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ

Rabbit Polyclonal Anti-RPE Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPE antibody: synthetic peptide directed towards the middle region of human RPE. Synthetic peptide located within the following region: MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK

Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656)

UGT1A9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A9

AKR1B1 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AKR1B1

Rabbit anti-UGT2B7 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT2B7

Rabbit polyclonal anti-GUSB antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GUSB.

Rabbit polyclonal AKR1B1 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This AKR1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 290-316 amino acids from the C-terminal region of human AKR1B1.

Rabbit anti-UGDH Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGDH

Rabbit anti-UGT1A4 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A4

Rabbit Polyclonal Anti-UGT1A6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A6 antibody: synthetic peptide directed towards the C terminal of human UGT1A6. Synthetic peptide located within the following region: APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK

Rabbit Polyclonal Anti-UGT2B15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT2B15 antibody: synthetic peptide directed towards the N terminal of human UGT2B15. Synthetic peptide located within the following region: IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY

Rabbit Polyclonal Anti-AKR1B1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the N terminal of human AKR1B1. Synthetic peptide located within the following region: ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN

Rabbit Polyclonal Anti-AKR1B1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1B1 antibody: synthetic peptide directed towards the C terminal of human AKR1B1. Synthetic peptide located within the following region: QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI

Rabbit Polyclonal Anti-UGP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGP2 antibody: synthetic peptide directed towards the N terminal of human UGP2. Synthetic peptide located within the following region: TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN

Rabbit Polyclonal antibody to UGT1A6 (UDP glucuronosyltransferase 1 family, polypeptide A6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 8 and 227 of UGT1A6 (Uniprot ID#P19224)

Rabbit polyclonal anti-AKR1B1 antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AKR1B1.

Rabbit polyclonal anti-UGDH antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human UGDH.

Rabbit Polyclonal Anti-UGT1A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the N terminal of human UGT1A1. Synthetic peptide located within the following region: DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR

Goat Polyclonal Antibody against DCXR

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence GSTLPVEGGFWAC, from the C Terminus of the protein sequence according to NP_057370.1.

Rabbit polyclonal Anti-UGT1A7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A7 antibody: synthetic peptide directed towards the N terminal of human UGT1A7. Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN

Rabbit Polyclonal Anti-GUSB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GUSB antibody: synthetic peptide directed towards the C terminal of human GUSB. Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF

Rabbit Polyclonal Anti-UGT1A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the middle region of human UGT1A1. Synthetic peptide located within the following region: ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH

Rabbit polyclonal antibody to XYLB (xylulokinase homolog (H. influenzae))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 473 and 536 of XYLB (Uniprot ID#O75191)

Rabbit polyclonal antibody to L-xylulose reductase (dicarbonyl/L-xylulose reductase)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 182 and 244 of DCXR (Uniprot ID#Q7Z4W1)

Rabbit Polyclonal anti-UGT1A9 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A9 antibody: synthetic peptide directed towards the N terminal of human UGT1A9. Synthetic peptide located within the following region: LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV

Rabbit polyclonal Anti-UGT1A5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A5 antibody: synthetic peptide directed towards the N terminal of human UGT1A5. Synthetic peptide located within the following region: EENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNM

Rabbit Polyclonal Anti-UGT2B4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT2B4 antibody: synthetic peptide directed towards the N terminal of human UGT2B4. Synthetic peptide located within the following region: NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE

Rabbit Polyclonal Anti-UGT2A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT2A3 antibody: synthetic peptide directed towards the N terminal of human UGT2A3. Synthetic peptide located within the following region: NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN

Rabbit Polyclonal Anti-UGT2A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT2A3 antibody: synthetic peptide directed towards the middle region of human UGT2A3. Synthetic peptide located within the following region: GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTR

Rabbit Polyclonal Anti-UGT1A4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A4 antibody: synthetic peptide directed towards the N terminal of human UGT1A4. Synthetic peptide located within the following region: VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK

Mouse Monoclonal AKR1B1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse Monoclonal AKR1B1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) UGDH mouse monoclonal antibody,clone OTI2C11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-AKR1B1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-AKR1B1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-AKR1B1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 304-316 amino acids of human aldo-keto reductase family 1, member B1 (aldose reductase)

Anti-AKR1B1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 304-316 amino acids of human aldo-keto reductase family 1, member B1 (aldose reductase)

Rabbit Polyclonal Anti-UGP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human UGP2

Rabbit Polyclonal Anti-UGT1A10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human UGT1A10

Rabbit Polyclonal Anti-UGT2B4 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human UGT2B4

Rabbit Polyclonal Anti-UGT1A6 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human UGT1A6

UGT1A6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

UGDH Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated