Products

cDNA Clones (32)
Proteins (17)
Antibodies (5)
Jump to Filters
View as table Download
PFKM (NM_000289) Human Tagged ORF Clone
RC200702

USD 420.00

In Stock

PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PFKM (NM_000289) Human Tagged ORF Clone Lentiviral Particle
RC200702L1V

USD 820.00

3 Weeks

Lenti ORF particles, PFKM (Myc-DDK tagged) - Human phosphofructokinase, muscle (PFKM), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PFKM (NM_000289) Human Tagged ORF Clone Lentiviral Particle
RC200702L2V

USD 820.00

6 Weeks

Lenti ORF particles, PFKM (mGFP-tagged) - Human phosphofructokinase, muscle (PFKM), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PFKM (NM_001166687) Human Tagged ORF Clone
RC230492

USD 420.00

In Stock

PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PFKM (NM_001166688) Human Tagged ORF Clone
RC230493

USD 420.00

In Stock

PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PFKM (NM_001166687) Human Tagged ORF Clone
RG230492

USD 460.00

In Stock

PFKM (GFP-tagged) - Human phosphofructokinase, muscle (PFKM), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PFKM (NM_000289) Human Tagged ORF Clone
RG200702

USD 460.00

In Stock

PFKM (GFP-tagged) - Human phosphofructokinase, muscle (PFKM), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PFKM (NM_000289) Human Tagged ORF Clone
RC200702L3

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphofructokinase, muscle (PFKM), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PFKM (NM_000289) Human Tagged ORF Clone Lentiviral Particle
RC200702L3V

USD 820.00

5 Weeks

Lenti ORF particles, PFKM (Myc-DDK tagged) - Human phosphofructokinase, muscle (PFKM), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PFKM (NM_000289) Human Tagged ORF Clone
RC200702L4

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphofructokinase, muscle (PFKM), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PFKM (NM_000289) Human Tagged ORF Clone Lentiviral Particle
RC200702L4V

USD 820.00

7 Weeks

Lenti ORF particles, PFKM (mGFP-tagged) - Human phosphofructokinase, muscle (PFKM), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PFKM (NM_001166687) Human Tagged ORF Clone
RC230492L3

USD 620.00

3 Weeks

Lenti-ORF clone of PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PFKM (NM_001166687) Human Tagged ORF Clone Lentiviral Particle
RC230492L3V

USD 820.00

6 Weeks

Lenti ORF particles, PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PFKM (NM_001166687) Human Tagged ORF Clone
RC230492L4

USD 620.00

3 Weeks

Lenti-ORF clone of PFKM (mGFP-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PFKM (NM_001166687) Human Tagged ORF Clone Lentiviral Particle
RC230492L4V

USD 820.00

6 Weeks

Lenti ORF particles, PFKM (mGFP-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PFKM (NM_001166688) Human Tagged ORF Clone
RC230493L3

USD 620.00

3 Weeks

Lenti-ORF clone of PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PFKM (NM_001166688) Human Tagged ORF Clone Lentiviral Particle
RC230493L3V

USD 820.00

6 Weeks

Lenti ORF particles, PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PFKM (NM_001166688) Human Tagged ORF Clone
RC230493L4

USD 620.00

3 Weeks

Lenti-ORF clone of PFKM (mGFP-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PFKM (NM_001166688) Human Tagged ORF Clone Lentiviral Particle
RC230493L4V

USD 820.00

6 Weeks

Lenti ORF particles, PFKM (mGFP-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PFKM (NM_001166686) Human Tagged ORF Clone
RC230541

USD 750.00

4 Weeks

PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PFKM (NM_001166686) Human Tagged ORF Clone
RC230541L3

USD 950.00

4 Weeks

Lenti-ORF clone of PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PFKM (NM_001166686) Human Tagged ORF Clone Lentiviral Particle
RC230541L3V

USD 1,150.00

7 Weeks

Lenti ORF particles, PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PFKM (NM_001166686) Human Tagged ORF Clone
RC230541L4

USD 950.00

4 Weeks

Lenti-ORF clone of PFKM (mGFP-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PFKM (NM_001166686) Human Tagged ORF Clone Lentiviral Particle
RC230541L4V

USD 1,150.00

7 Weeks

Lenti ORF particles, PFKM (mGFP-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PFKM (NM_001166688) Human Tagged ORF Clone
RG230493

USD 460.00

3 Weeks

PFKM (GFP-tagged) - Human phosphofructokinase, muscle (PFKM), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PFKM (NM_001166686) Human Tagged ORF Clone
RG230541

USD 830.00

5 Weeks

PFKM (GFP-tagged) - Human phosphofructokinase, muscle (PFKM), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PFKM Rabbit Polyclonal Antibody
TA308655

USD 415.00

5 Days

Rabbit Polyclonal antibody to PFK (muscle) (phosphofructokinase, muscle)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 253 of PFK (muscle) (Uniprot ID#P08237)
PFKM (NM_000289) Human Tagged ORF Clone
RC200702L1

USD 768.00

In Stock

Lenti ORF clone of Human phosphofructokinase, muscle (PFKM), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PFKM (NM_000289) Human Untagged Clone
SC320270

USD 310.00

In Stock

PFKM (untagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 4

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
PFKM Rabbit Polyclonal Antibody
TA332713

USD 275.00

3 Weeks

Rabbit anti-PFKM Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PFKM
PFKM Mouse Monoclonal Antibody [Clone ID: AT2F11]
AM50026PU-N

USD 340.00

2 Weeks

PFKM mouse monoclonal antibody, clone AT2F11, Purified

Applications ELISA, FC, WB
Reactivities Human
PFKM Mouse Monoclonal Antibody [Clone ID: AT2F11]
AM50026PU-S

USD 230.00

2 Weeks

PFKM mouse monoclonal antibody, clone AT2F11, Purified

Applications ELISA, FC, WB
Reactivities Human
PFKM (NM_000289) Human Tagged ORF Clone
RC200702L2

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphofructokinase, muscle (PFKM), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PFKM (NM_000289) Human Over-expression Lysate
LC424822

USD 121.00

In Stock

PFKM HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PFKM (NM_001166687) Human Untagged Clone
SC329130

USD 760.00

2 Weeks

PFKM (untagged)-Human phosphofructokinase muscle (PFKM) transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
PFKM Rabbit Polyclonal Antibody
TA343124

USD 375.00

5 Days

Rabbit Polyclonal Anti-PFKM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PFKM antibody: synthetic peptide directed towards the C terminal of human PFKM. Synthetic peptide located within the following region: RALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHA
PFKM (1-780, His-tag) Human Protein
AR09446PU-L

USD 1,105.00

2 Weeks

PFKM (1-780, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
PFKM (1-780, His-tag) Human Protein
AR09446PU-N

USD 415.00

2 Weeks

PFKM (1-780, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
PFKM (NM_000289) Human Over-expression Lysate
LY424822

USD 396.00

5 Days

Transient overexpression lysate of phosphofructokinase, muscle (PFKM), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PFKM (NM_000289) Human Mass Spec Standard
PH300702

USD 2,055.00

3 Weeks

PFKM MS Standard C13 and N15-labeled recombinant protein (NP_000280)

Tag C-Myc/DDK
Expression Host HEK293
PFKM (NM_001166688) Human Untagged Clone
SC329131

USD 760.00

5 Weeks

PFKM (untagged)-Human phosphofructokinase muscle (PFKM) transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PFKM (NM_001166686) Human Untagged Clone
SC329179

USD 1,730.00

5 Weeks

PFKM (untagged)-Human phosphofructokinase muscle (PFKM) transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PFKM ICC Control Block
TB400702

USD 1,070.00

4 Weeks

Transient overexpression of PFKM (NM_000289) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PFKM ICC Control Block
TB430492

USD 1,070.00

4 Weeks

Transient overexpression of PFKM (NM_001166687) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PFKM ICC Control Block
TB430493

USD 1,070.00

4 Weeks

Transient overexpression of PFKM (NM_001166688) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PFKM ICC Control Block
TB430541

USD 1,400.00

4 Weeks

Transient overexpression of PFKM (NM_001166686) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PFKM Cytosection
TS400702

USD 225.00

4 Weeks

Transient overexpression of PFKM (NM_000289) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PFKM Cytosection
TS400702P5

USD 889.00

4 Weeks

Transient overexpression of PFKM (NM_000289) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PFKM Cytosection
TS430492

USD 225.00

4 Weeks

Transient overexpression of PFKM (NM_001166687) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack