TKT (Myc-DDK-tagged)-Human transketolase (TKT), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TKT (Myc-DDK-tagged)-Human transketolase (TKT), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TKT (Myc-DDK-tagged)-Human transketolase (TKT), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human transketolase (TKT), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
TKT (GFP-tagged) - Human transketolase (TKT), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, TKT (Myc-DDK tagged) - Human transketolase (TKT), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, TKT (mGFP-tagged) - Human transketolase (TKT), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
3 Weeks
Lenti ORF particles, TKT (Myc-DDK tagged) - Human transketolase (TKT), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, TKT (mGFP-tagged) - Human transketolase (TKT), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Rabbit monoclonal anti-TKT antibody for SISCAPA, clone OTIR4F5
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 820.00
5 Weeks
Lenti ORF particles, TKT (Myc-DDK tagged) - Human transketolase (TKT), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, TKT (mGFP-tagged) - Human transketolase (TKT), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human transketolase (TKT), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, TKT (Myc-DDK tagged) - Human transketolase (TKT), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human transketolase (TKT), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, TKT (mGFP-tagged) - Human transketolase (TKT), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TKT (Myc-DDK tagged) - Homo sapiens transketolase (TKT), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TKT (GFP-tagged) - Human transketolase (TKT), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TKT (GFP-tagged) - Homo sapiens transketolase (TKT), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human transketolase (TKT), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human transketolase (TKT), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
TKT (untagged)-Human transketolase (TKT), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-TKT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TKT antibody: synthetic peptide directed towards the N terminal of human TKT. Synthetic peptide located within the following region: ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL |
Lenti ORF clone of Human transketolase (TKT), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human transketolase (TKT), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
TKT HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of transketolase (TKT), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transketolase (TKT) (1-623, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
Transketolase (TKT) (1-623, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) TKT mouse monoclonal antibody, clone OTI5H3 (formerly 5H3)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TKT HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of transketolase (TKT), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
TKT MS Standard C13 and N15-labeled recombinant protein (NP_001055)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
TKT MS Standard C13 and N15-labeled recombinant protein (NP_001128527)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
TKT (untagged)-Human transketolase (TKT), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
TKT (untagged) - Homo sapiens transketolase (TKT), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
Rabbit Polyclonal Anti-TKT Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TKT |
Anti-TKT (Transketolase) mouse monoclonal antibody, clone OTI5H3 (formerly 5H3)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-TKT (Transketolase) mouse monoclonal antibody, clone OTI5H3 (formerly 5H3), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-TKT (Transketolase) mouse monoclonal antibody, clone OTI5H3 (formerly 5H3), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-TKT (Transketolase) mouse monoclonal antibody, clone OTI5H3 (formerly 5H3)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of TKT (NM_001064) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TKT (NM_001135055) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TKT (NM_001258028) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TKT (NM_001064) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TKT (NM_001064) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TKT (NM_001135055) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TKT (NM_001135055) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TKT (NM_001258028) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack