Products

View as table Download

IL4I1 (Myc-DDK-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

IL4I1 (Myc-DDK-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, IL4I1 (Myc-DDK tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, IL4I1 (mGFP-tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

IL4I1 (GFP-tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

IL4I1 (Myc-DDK tagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

IL4I1 (Myc-DDK tagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of IL4I1 (Myc-DDK-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, IL4I1 (Myc-DDK-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of IL4I1 (mGFP-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, IL4I1 (mGFP-tagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human interleukin 4 induced 1 (IL4I1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, IL4I1 (Myc-DDK tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human interleukin 4 induced 1 (IL4I1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, IL4I1 (mGFP-tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

IL4I1 (GFP-tagged) - Human interleukin 4 induced 1 (IL4I1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

IL4I1 (GFP-tagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

IL4I1 (GFP-tagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human interleukin 4 induced 1 (IL4I1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human interleukin 4 induced 1 (IL4I1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit polyclonal anti-IL4I1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human IL4I1.

IL4I1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

IL4I1 (untagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-IL4I1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL4I1 antibody is: synthetic peptide directed towards the C-terminal region of Human IL4I1. Synthetic peptide located within the following region: PHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVAS

IL4I1 MS Standard C13 and N15-labeled recombinant protein (NP_758962)

Tag C-Myc/DDK
Expression Host HEK293

IL4I1 (untagged)-Human interleukin 4 induced 1 (IL4I1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

IL4I1 (untagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 3

Vector pCMV6 series
Tag Tag Free

IL4I1 (untagged) - Homo sapiens interleukin 4 induced 1 (IL4I1), transcript variant 4

Vector pCMV6 series
Tag Tag Free

Transient overexpression of IL4I1 (NM_152899) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of IL4I1 (NM_172374) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of IL4I1 (NM_001258017) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of IL4I1 (NM_001258018) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Purified recombinant protein of Human interleukin 4 induced 1 (IL4I1), Gln22-End, with C-terminal His tag, secretory expressed in HEK293 cells, 50 ug

Tag C-HIS
Expression Host HEK293

USD 225.00

4 Weeks

Transient overexpression of IL4I1 (NM_152899) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of IL4I1 (NM_152899) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of IL4I1 (NM_172374) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of IL4I1 (NM_172374) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of IL4I1 (NM_001258017) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of IL4I1 (NM_001258017) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of IL4I1 (NM_001258018) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of IL4I1 (NM_001258018) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack