Products

cDNA Clones (10)
Proteins (8)
Antibodies (3)
Jump to Filters
View as table Download
UGT (UGT1A1) (NM_000463) Human Tagged ORF Clone
RC213439

USD 420.00

In Stock

UGT1A1 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
UGT (UGT1A1) (NM_000463) Human Tagged ORF Clone Lentiviral Particle
RC213439L2V

USD 820.00

6 Weeks

Lenti ORF particles, UGT1A1 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
UGT (UGT1A1) (NM_000463) Human Tagged ORF Clone
RG213439

USD 460.00

In Stock

UGT1A1 (GFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UGT (UGT1A1) (NM_000463) Human Tagged ORF Clone
RC213439L3

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT (UGT1A1) (NM_000463) Human Tagged ORF Clone Lentiviral Particle
RC213439L3V

USD 820.00

5 Weeks

Lenti ORF particles, UGT1A1 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT (UGT1A1) (NM_000463) Human Tagged ORF Clone
RC213439L4

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT (UGT1A1) (NM_000463) Human Tagged ORF Clone Lentiviral Particle
RC213439L4V

USD 820.00

7 Weeks

Lenti ORF particles, UGT1A1 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT (UGT1A1) Rabbit Polyclonal Antibody
TA332982

USD 345.00

2 Weeks

Rabbit anti-UGT1A1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UGT1A1
UGT (UGT1A1) (NM_000463) Human Untagged Clone
SC313894

USD 760.00

In Stock

UGT1A1 (untagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
UGT (UGT1A1) (NM_000463) Human Tagged ORF Clone
RC213439L2

USD 620.00

3 Weeks

Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
UGT (UGT1A1) Rabbit Polyclonal Antibody
TA335239

USD 375.00

5 Days

Rabbit Polyclonal Anti-UGT1A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the N terminal of human UGT1A1. Synthetic peptide located within the following region: DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR
UGT (UGT1A1) (NM_000463) Human Over-expression Lysate
LC424698

USD 187.00

In Stock

UGT1A1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
UGT (UGT1A1) Rabbit Polyclonal Antibody
TA335240

USD 310.00

5 Days

Rabbit Polyclonal Anti-UGT1A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the middle region of human UGT1A1. Synthetic peptide located within the following region: ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH
UGT (UGT1A1) (NM_000463) Human Mass Spec Standard
PH313439

USD 2,055.00

3 Weeks

UGT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_000454)

Tag C-Myc/DDK
Expression Host HEK293
UGT1A1 (26-490, His-tag) Human Protein
AR51834PU-N

USD 845.00

2 Weeks

UGT1A1 (26-490, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
UGT1A1 (26-490, His-tag) Human Protein
AR51834PU-S

USD 330.00

2 Weeks

UGT1A1 (26-490, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
UGT (UGT1A1) ICC Control Block
TB413439

USD 1,070.00

4 Weeks

Transient overexpression of UGT1A1 (NM_000463) in HEK293T cells paraffin embedded controls for ICC/IHC staining

UGT (UGT1A1) Cytosection
TS413439

USD 225.00

4 Weeks

Transient overexpression of UGT1A1 (NM_000463) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

UGT (UGT1A1) Cytosection
TS413439P5

USD 889.00

4 Weeks

Transient overexpression of UGT1A1 (NM_000463) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack