Germany
Japan
United Kingdom
China
UGT1A1 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Ugt1a1 (Myc-DDK-tagged) - Mouse UDP glucuronosyltransferase 1 family, polypeptide A1 (Ugt1a1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, UGT1A1 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, UGT1A1 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
UGT1A1 (GFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
UGT1A1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN413439 is the updated version of KN213439.
Ugt1a1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN518663 is the updated version of KN318663.
Ugt1a1 (GFP-tagged) - Mouse UDP glucuronosyltransferase 1 family, polypeptide A1 (cDNA clone MGC:103216 IMAGE:5135493)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ugt1a1 (GFP-tagged) - Mouse UDP glucuronosyltransferase 1 family polypeptide A1 (Ugt1a1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ugt1a1 (Myc-DDK-tagged) - Mouse UDP glucuronosyltransferase 1 family, polypeptide A1 (cDNA clone MGC:103216 IMAGE:5135493)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ugt1a1 (Myc-DDK-tagged) - Mouse UDP glucuronosyltransferase 1 family, polypeptide A1 (cDNA clone MGC:103216 IMAGE:5135493)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ugt1a1 (Myc-DDK-tagged) - Mouse UDP glucuronosyltransferase 1 family, polypeptide A1 (cDNA clone MGC:103216 IMAGE:5135493), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ugt1a1 (mGFP-tagged) - Mouse UDP glucuronosyltransferase 1 family, polypeptide A1 (cDNA clone MGC:103216 IMAGE:5135493)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ugt1a1 (GFP-tagged) - Mouse UDP glucuronosyltransferase 1 family, polypeptide A1 (cDNA clone MGC:103216 IMAGE:5135493), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ugt1a1 (Myc-DDK-tagged) - Mouse UDP glucuronosyltransferase 1 family, polypeptide A1 (Ugt1a1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ugt1a1 (Myc-DDK-tagged) - Mouse UDP glucuronosyltransferase 1 family, polypeptide A1 (Ugt1a1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ugt1a1 (mGFP-tagged) - Mouse UDP glucuronosyltransferase 1 family, polypeptide A1 (Ugt1a1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ugt1a1 (GFP-tagged) - Mouse UDP glucuronosyltransferase 1 family, polypeptide A1 (Ugt1a1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, UGT1A1 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, UGT1A1 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ugt1a1 (Myc-DDK-tagged ORF) - Rat UDP glucuronosyltransferase 1 family, polypeptide A1 (Ugt1a1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ugt1a1 (Myc-DDK-tagged ORF) - Rat UDP glucuronosyltransferase 1 family, polypeptide A1 (Ugt1a1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ugt1a1 (Myc-DDK-tagged ORF) - Rat UDP glucuronosyltransferase 1 family, polypeptide A1 (Ugt1a1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ugt1a1 (mGFP-tagged ORF) - Rat UDP glucuronosyltransferase 1 family, polypeptide A1 (Ugt1a1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ugt1a1 (GFP-tagged ORF) - Rat UDP glucuronosyltransferase 1 family, polypeptide A1 (Ugt1a1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit anti-UGT1A1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A1 |
Transient overexpression lysate of UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
UGT1A1 (untagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-UGT1A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the N terminal of human UGT1A1. Synthetic peptide located within the following region: DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR |
UGT1A1 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
UGT1A1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-UGT1A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the middle region of human UGT1A1. Synthetic peptide located within the following region: ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH |
UGT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_000454)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
UGT1A1 (26-490, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
UGT1A1 (26-490, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
UGT1A1 CRISPRa kit - CRISPR gene activation of human UDP glucuronosyltransferase family 1 member A1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Ugt1a1 CRISPRa kit - CRISPR gene activation of mouse UDP glucuronosyltransferase 1 family, polypeptide A1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene UGT1A1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Ugt1a1 (untagged) - Mouse UDP glucuronosyltransferase 1 family, polypeptide A1 (Ugt1a1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Ugt1a1 (untagged) - Mouse UDP glucuronosyltransferase 1 family, polypeptide A1 (cDNA clone MGC:103216 IMAGE:5135493), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Ugt1a1
Ugt1a1 (untagged ORF) - Rat UDP glucuronosyltransferase 1 family, polypeptide A1 (Ugt1a1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of UDP glucuronosyltransferase 1 family polypeptide A1 (UGT1A1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Ugt1a1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Ugt1a1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
UGT1A1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse UGT1A1 |
UGT1A1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human UGT1A1 (NP_000454.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- UGT1A1
Filter by
Species
Antibody Hosts
Isotypes
Clonalities
Conjugates
Expression Hosts
Lentivirus
Vectors
Modifications
Mutants
Mammalian Cell Selection
Families
Pathways
- Androgen and estrogen metabolism (21)
- Ascorbate and aldarate metabolism (21)
- Drug metabolism - cytochrome P450 (21)
- Drug metabolism - other enzymes (21)
- Metabolic pathways (21)
- Metabolism of xenobiotics by cytochrome P450 (21)
- Pentose and glucuronate interconversions (21)
- Porphyrin and chlorophyll metabolism (21)
- Retinol metabolism (21)
- Starch and sucrose metabolism (21)