TAP1 (Myc-DDK-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
TAP1 (Myc-DDK-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, TAP1 (Myc-DDK-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, TAP1 (mGFP-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
TAP1 (GFP-tagged) - Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of TAP1 (Myc-DDK-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TAP1 (Myc-DDK-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of TAP1 (mGFP-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TAP1 (mGFP-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TAP1 (myc-DDK-tagged) - Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TAP1 (untagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti-ORF clone of TAP1 (Myc-DDK-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti-ORF clone of TAP1 (mGFP-tagged)-Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-TAP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL |
Goat Anti-TAP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QKFREKLQEIKT, from the internal region of the protein sequence according to NP_000584.2. |
TAP1 (GFP-tagged) - Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TAP1 (untagged) - Human transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (TAP1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of TAP1 (NM_000593) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TAP1 (NM_001292022) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TAP1 (NM_000593) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TAP1 (NM_000593) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TAP1 (NM_001292022) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack