Germany
Japan
United Kingdom
China
NCAM2 (Myc-DDK-tagged)-Human neural cell adhesion molecule 2 (NCAM2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, NCAM2 (Myc-DDK-tagged)-Human neural cell adhesion molecule 2 (NCAM2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, NCAM2 (mGFP-tagged)-Human neural cell adhesion molecule 2 (NCAM2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti-ORF clone of NCAM2 (Myc-DDK-tagged)-Human neural cell adhesion molecule 2 (NCAM2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NCAM2 (Myc-DDK-tagged)-Human neural cell adhesion molecule 2 (NCAM2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NCAM2 (mGFP-tagged)-Human neural cell adhesion molecule 2 (NCAM2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, NCAM2 (mGFP-tagged)-Human neural cell adhesion molecule 2 (NCAM2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NCAM2 (GFP-tagged) - Human neural cell adhesion molecule 2 (NCAM2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NCAM2 (untagged)-Human neural cell adhesion molecule 2 (NCAM2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti-ORF clone of NCAM2 (Myc-DDK-tagged)-Human neural cell adhesion molecule 2 (NCAM2)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of NCAM2 (mGFP-tagged)-Human neural cell adhesion molecule 2 (NCAM2)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
NCAM2 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NCAM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCAM2 antibody: synthetic peptide directed towards the middle region of human NCAM2. Synthetic peptide located within the following region: KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPIL |
Transient overexpression of NCAM2 (NM_004540) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NCAM2 (NM_004540) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NCAM2 (NM_004540) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- NCAM2
Pathways
- Prion diseases