Germany
Japan
United Kingdom
China
PSMB10 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, beta type, 10 (PSMB10)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 10 (PSMB10), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PSMB10 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, beta type, 10 (PSMB10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 10 (PSMB10), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PSMB10 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 10 (PSMB10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PSMB10 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 10 (PSMB10)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSMB10 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PSMB10 (untagged)-Human proteasome (prosome, macropain) subunit, beta type, 10 (PSMB10)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PSMB10 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 213-242 amino acids from the C-terminal region of Human PSMB10 |
Rabbit polyclonal Anti-PSMB10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB10 antibody: synthetic peptide directed towards the middle region of human PSMB10. Synthetic peptide located within the following region: DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG |
PSMB10 (40-273, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
PSMB10 (40-273, His-tag) human recombinant protein, 10 µg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 10 (PSMB10)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression of PSMB10 (NM_002801) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSMB10 (NM_002801) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PSMB10 (NM_002801) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PSMB10
Pathways
- Proteasome