Products

View as table Download

USD 98.00

USD 390.00

In Stock

PSMB3 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PSMB3 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PSMB3 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PSMB3 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PSMB3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PSMB3 (untagged)-Human proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SC118416 is the updated version of SC125384.

PSMB3 (untagged)-Human proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Goat Anti-PSMB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NLYELKEGRQ, from the internal region of the protein sequence according to NP_002786.2.

Rabbit polyclonal Anti-PSMB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMB3 antibody: synthetic peptide directed towards the middle region of human PSMB3. Synthetic peptide located within the following region: LNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF

PSMB3 (1-205, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

PSMB3 (1-205, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

USD 1,040.00

4 Weeks

Transient overexpression of PSMB3 (NM_002795) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of PSMB3 (NM_002795) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of PSMB3 (NM_002795) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack