PSMB3 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PSMB3 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PSMB3 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PSMB3 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PSMB3 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PSMB3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PSMB3 (untagged)-Human proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PSMB3 (untagged)-Human proteasome (prosome, macropain) subunit, beta type, 3 (PSMB3)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Goat Anti-PSMB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NLYELKEGRQ, from the internal region of the protein sequence according to NP_002786.2. |
Rabbit polyclonal Anti-PSMB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSMB3 antibody: synthetic peptide directed towards the middle region of human PSMB3. Synthetic peptide located within the following region: LNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF |
PSMB3 (1-205, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
PSMB3 (1-205, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Transient overexpression of PSMB3 (NM_002795) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSMB3 (NM_002795) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PSMB3 (NM_002795) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack