Germany
Japan
United Kingdom
China
USD 98.00
USD 390.00
In Stock
PSMB4 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, beta type, 4 (PSMB4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 823.00
In Stock
Recombinant protein of human proteasome (prosome, macropain) subunit, beta type, 4 (PSMB4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 460.00
In Stock
PSMB4 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 4 (PSMB4)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 620.00
3 Weeks
Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 4 (PSMB4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PSMB4 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, beta type, 4 (PSMB4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 4 (PSMB4), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PSMB4 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 4 (PSMB4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit anti-PSMB4 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSMB4 |
USD 420.00
In Stock
PSMB4 (untagged)-Human proteasome (prosome, macropain) subunit, beta type, 4 (PSMB4)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 121.00
In Stock
PSMB4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 420.00
In Stock
PSMB4 (untagged)-Human proteasome (prosome, macropain) subunit, beta type, 4 (PSMB4)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
USD 396.00
5 Days
Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 4 (PSMB4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal Anti-PSMB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB4 antibody: synthetic peptide directed towards the middle region of human PSMB4. Synthetic peptide located within the following region: YLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMV |
Rabbit polyclonal Anti-PSMB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB4 antibody: synthetic peptide directed towards the middle region of human PSMB4. Synthetic peptide located within the following region: SRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQ |
PSMB4 / PROS26 (46-264, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
PSMB4 / PROS26 (46-264, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) PSMB4 mouse monoclonal antibody, clone OTI6F10 (formerly 6F10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 2,055.00
3 Weeks
PSMB4 MS Standard C13 and N15-labeled recombinant protein (NP_002787)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
PSMB4 (Proteasome subunit beta type 4 ) mouse monoclonal antibody, clone OTI6F10 (formerly 6F10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PSMB4 (Proteasome subunit beta type 4 ) mouse monoclonal antibody, clone OTI6F10 (formerly 6F10), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
PSMB4 (Proteasome subunit beta type 4 ) mouse monoclonal antibody, clone OTI6F10 (formerly 6F10), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
PSMB4 (Proteasome subunit beta type 4 ) mouse monoclonal antibody, clone OTI6F10 (formerly 6F10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
USD 420.00
4 Weeks
Active filters
Target Symbol
- PSMB4
Pathways
- Proteasome