Germany
Japan
United Kingdom
China
PSMD3 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 (PSMD3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 (PSMD3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
PSMD3 (GFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 (PSMD3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 (PSMD3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PSMD3 (Myc-DDK tagged) - Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 (PSMD3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 (PSMD3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PSMD3 (mGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 (PSMD3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 (PSMD3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
PSMD3 (untagged)-Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 (PSMD3)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Proteasome 19S S3 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody was made against a protein fragment from the N-Terminus Region |
PSMD3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
PSMD3 (untagged)-Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 (PSMD3)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal Anti-PSMD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD3 antibody: synthetic peptide directed towards the N terminal of human PSMD3. Synthetic peptide located within the following region: RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAAS |
Rabbit polyclonal Anti-PSMD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD3 antibody: synthetic peptide directed towards the middle region of human PSMD3. Synthetic peptide located within the following region: YSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQ |
PSMD3 MS Standard C13 and N15-labeled recombinant protein (NP_002800)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Anti-PSMD3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 |
Anti-PSMD3 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of PSMD3 (NM_002809) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSMD3 (NM_002809) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PSMD3 (NM_002809) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PSMD3
Pathways
- Proteasome