Products

View as table Download

Rabbit Polyclonal Anti-THOC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-THOC1 antibody: synthetic peptide directed towards the C terminal of human THOC1. Synthetic peptide located within the following region: TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES

Rabbit Polyclonal Anti-THOC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-THOC1 antibody is: synthetic peptide directed towards the C-terminal region of Human THOC1. Synthetic peptide located within the following region: NEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWSL

Nuclear Matrix Protein p84 (THOC1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 540-570 amino acids from the C-terminal region of human THOC1

Rabbit Polyclonal antibody to Nuclear Matrix Protein p84 (THO complex 1)

Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 404 of Nuclear Matrix Protein p84

Transient overexpression of THOC1 (NM_005131) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of THOC1 (NM_005131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of THOC1 (NM_005131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack