Products

cDNA Clones (25)
RNAi (11)
Antibodies (7)
Proteins (7)
Gene Expression (6)
Jump to Filters
View as table Download
Nuclear Matrix Protein p84 (THOC1) Rabbit Polyclonal Antibody
TA345913

USD 475.00

5 Days

Rabbit Polyclonal Anti-THOC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-THOC1 antibody: synthetic peptide directed towards the C terminal of human THOC1. Synthetic peptide located within the following region: TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES
Nuclear Matrix Protein p84 (THOC1) Human Gene Knockout Kit (CRISPR)
KN403117

USD 1,290.00

2 Weeks

THOC1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN403117 is the updated version of KN203117.
Thoc1 Mouse Gene Knockout Kit (CRISPR)
KN517531

USD 1,290.00

2 Weeks

Thoc1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN517531 is the updated version of KN317531.
Thoc1 (NM_153552) Mouse Tagged ORF Clone
MG209815

USD 760.00

3 Weeks

Thoc1 (GFP-tagged) - Mouse THO complex 1 (Thoc1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Thoc1 (NM_153552) Mouse Tagged ORF Clone
MR209815

USD 690.00

3 Weeks

Thoc1 (Myc-DDK-tagged) - Mouse THO complex 1 (Thoc1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Thoc1 (NM_153552) Mouse Tagged ORF Clone
MR209815L3

USD 890.00

8 Weeks

Lenti ORF clone of Thoc1 (Myc-DDK-tagged) - Mouse THO complex 1 (Thoc1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Thoc1 (NM_153552) Mouse Tagged ORF Clone
MR209815L4

USD 890.00

8 Weeks

Lenti ORF clone of Thoc1 (mGFP-tagged) - Mouse THO complex 1 (Thoc1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Thoc1 (NM_001047850) Rat Tagged ORF Clone
RR208001

USD 680.00

5 Weeks

Thoc1 (Myc-DDK-tagged ORF) - Rat THO complex 1 (Thoc1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Thoc1 (NM_001047850) Rat Tagged ORF Clone
RR208001L3

USD 880.00

8 Weeks

Lenti ORF clone of Thoc1 (Myc-DDK-tagged ORF) - Rat THO complex 1 (Thoc1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Thoc1 (NM_001047850) Rat Tagged ORF Clone
RR208001L4

USD 960.00

8 Weeks

Lenti ORF clone of Thoc1 (mGFP-tagged ORF) - Rat THO complex 1 (Thoc1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nuclear Matrix Protein p84 (THOC1) Rabbit Polyclonal Antibody
TA345912

USD 475.00

5 Days

Rabbit Polyclonal Anti-THOC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-THOC1 antibody is: synthetic peptide directed towards the C-terminal region of Human THOC1. Synthetic peptide located within the following region: NEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWSL
Nuclear Matrix Protein p84 (THOC1) (C-term) Rabbit Polyclonal Antibody
AP54240PU-N

USD 512.00

2 Weeks

Nuclear Matrix Protein p84 (THOC1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 540-570 amino acids from the C-terminal region of human THOC1
Nuclear Matrix Protein p84 (THOC1) Rabbit Polyclonal Antibody
TA308394

USD 415.00

5 Days

Rabbit Polyclonal antibody to Nuclear Matrix Protein p84 (THO complex 1)

Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 404 of Nuclear Matrix Protein p84
Human Nuclear Matrix Protein p84 (THOC1) activation kit by CRISPRa
GA106757

USD 1,290.00

2 Weeks

THOC1 CRISPRa kit - CRISPR gene activation of human THO complex 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
THOC1 Human qPCR Template Standard (NM_005131)
HK207315

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene THOC1

Application Plasmid of exact quantity for transcript copy number calculation
Thoc1 (NM_153552) Mouse Untagged Clone
MC220201

USD 890.00

3 Weeks

Thoc1 (untagged) - Mouse THO complex 1 (Thoc1), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Thoc1 Mouse qPCR Primer Pair (NM_153552)
MP216912

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Thoc1

Thoc1 (NM_001047850) Rat Untagged Clone
RN208001

USD 680.00

4 Weeks

Thoc1 (untagged ORF) - Rat THO complex 1 (Thoc1), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Nuclear Matrix Protein p84 (THOC1) (NM_005131) Human 3' UTR Clone
SC200905

USD 560.00

4 Weeks

3`UTR clone of THO complex 1 (THOC1) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
Thoc1 Mouse siRNA Oligo Duplex (Locus ID 225160)
SR418769

USD 430.00

2 Weeks

Thoc1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).
Thoc1 Rat siRNA Oligo Duplex (Locus ID 291797)
SR507715

USD 430.00

2 Weeks

Thoc1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Nuclear Matrix Protein p84 (THOC1) Rabbit Polyclonal Antibody
TA382502

USD 275.00

3 Weeks

Nuclear Matrix Protein p84 (THOC1) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 428-657 of human Nuclear Matrix Protein p84 (Nuclear Matrix Protein p84 (THOC1)) (NP_005122.2).
Modifications Unmodified
Nuclear Matrix Protein p84 (THOC1) Rabbit Polyclonal Antibody
TA385406

USD 380.00

4 Weeks

THO Complex Subunit 1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of human Nuclear Matrix Protein p84
Nuclear Matrix Protein p84 (THOC1) (NM_005131) ICC Control Block
TB403117

USD 1,130.00

4 Weeks

Transient overexpression of THOC1 (NM_005131) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Thoc1 Mouse shRNA Plasmid (Locus ID 225160)
TL513523

USD 815.00

2 Weeks

Thoc1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
Thoc1 Mouse shRNA Lentiviral Particle (Locus ID 225160)
TL513523V

USD 1,395.00

5 Weeks

Thoc1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
Thoc1 Rat shRNA Plasmid (Locus ID 291797)
TL703796

USD 815.00

2 Weeks

Thoc1 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti