Products

cDNA Clones (14)
Proteins (9)
Antibodies (1)
Jump to Filters
View as table Download
ENTPD8 (NM_001033113) Human Tagged ORF Clone
RC218598

USD 420.00

In Stock

ENTPD8 (Myc-DDK-tagged)-Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ENTPD8 (NM_001033113) Human Tagged ORF Clone
RG218598

USD 460.00

In Stock

ENTPD8 (GFP-tagged) - Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ENTPD8 (NM_198585) Human Tagged ORF Clone
RC220938

USD 420.00

In Stock

ENTPD8 (Myc-DDK-tagged)-Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ENTPD8 (NM_001033113) Human Tagged ORF Clone
RC218598L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ENTPD8 (NM_001033113) Human Tagged ORF Clone Lentiviral Particle
RC218598L3V

USD 820.00

6 Weeks

Lenti ORF particles, ENTPD8 (Myc-DDK tagged) - Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ENTPD8 (NM_001033113) Human Tagged ORF Clone
RC218598L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ENTPD8 (NM_001033113) Human Tagged ORF Clone Lentiviral Particle
RC218598L4V

USD 820.00

6 Weeks

Lenti ORF particles, ENTPD8 (mGFP-tagged) - Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ENTPD8 (NM_198585) Human Tagged ORF Clone
RC220938L3

USD 620.00

3 Weeks

Lenti-ORF clone of ENTPD8 (Myc-DDK-tagged)-Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ENTPD8 (NM_198585) Human Tagged ORF Clone Lentiviral Particle
RC220938L3V

USD 820.00

6 Weeks

Lenti ORF particles, ENTPD8 (Myc-DDK-tagged)-Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ENTPD8 (NM_198585) Human Tagged ORF Clone
RC220938L4

USD 620.00

3 Weeks

Lenti-ORF clone of ENTPD8 (mGFP-tagged)-Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ENTPD8 (NM_198585) Human Tagged ORF Clone Lentiviral Particle
RC220938L4V

USD 820.00

6 Weeks

Lenti ORF particles, ENTPD8 (mGFP-tagged)-Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ENTPD8 (NM_198585) Human Tagged ORF Clone
RG220938

USD 460.00

3 Weeks

ENTPD8 (GFP-tagged) - Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ENTPD8 (NM_001033113) Human Untagged Clone
SC311389

USD 830.00

In Stock

ENTPD8 (untagged)-Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ENTPD8 Rabbit Polyclonal Antibody
TA336025

USD 375.00

5 Days

Rabbit Polyclonal Anti-ENTPD8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENTPD8 Antibody: synthetic peptide directed towards the N terminal of human ENTPD8. Synthetic peptide located within the following region: IPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWG
ENTPD8 (NM_001033113) Human Over-expression Lysate
LC422368

USD 187.00

2 Weeks

ENTPD8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ENTPD8 (NM_001033113) Human Over-expression Lysate
LY422368

USD 605.00

5 Days

Transient overexpression lysate of ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ENTPD8 (NM_001033113) Human Mass Spec Standard
PH318598

USD 2,055.00

3 Weeks

ENTPD8 MS Standard C13 and N15-labeled recombinant protein (NP_001028285)

Tag C-Myc/DDK
Expression Host HEK293
ENTPD8 (NM_198585) Human Untagged Clone
SC307761

USD 760.00

3 Weeks

ENTPD8 (untagged)-Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 2

Vector pCMV6 series
Tag Tag Free
ENTPD8 ICC Control Block
TB418598

USD 1,070.00

4 Weeks

Transient overexpression of ENTPD8 (NM_001033113) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ENTPD8 (NM_198585) ICC Control Block
TB420938

USD 1,070.00

4 Weeks

Transient overexpression of ENTPD8 (NM_198585) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ENTPD8 Cytosection
TS418598

USD 225.00

4 Weeks

Transient overexpression of ENTPD8 (NM_001033113) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ENTPD8 Cytosection
TS418598P5

USD 889.00

4 Weeks

Transient overexpression of ENTPD8 (NM_001033113) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ENTPD8 Cytosection
TS420938

USD 225.00

4 Weeks

Transient overexpression of ENTPD8 (NM_198585) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ENTPD8 Cytosection
TS420938P5

USD 889.00

4 Weeks

Transient overexpression of ENTPD8 (NM_198585) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack