Germany
Japan
United Kingdom
China
ENTPD8 (Myc-DDK-tagged)-Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
ENTPD8 (GFP-tagged) - Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Entpd8 (Myc-DDK-tagged) - Mouse ectonucleoside triphosphate diphosphohydrolase 8 (Entpd8)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ENTPD8 (Myc-DDK-tagged)-Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ENTPD8 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN418598 is the updated version of KN218598.
Entpd8 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN505253 is the updated version of KN305253.
Entpd8 (GFP-tagged) - Mouse ectonucleoside triphosphate diphosphohydrolase 8 (Entpd8)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Entpd8 (Myc-DDK-tagged) - Mouse ectonucleoside triphosphate diphosphohydrolase 8 (Entpd8)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Entpd8 (Myc-DDK-tagged) - Mouse ectonucleoside triphosphate diphosphohydrolase 8 (Entpd8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Entpd8 (mGFP-tagged) - Mouse ectonucleoside triphosphate diphosphohydrolase 8 (Entpd8)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Entpd8 (GFP-tagged) - Mouse ectonucleoside triphosphate diphosphohydrolase 8 (Entpd8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ENTPD8 (Myc-DDK tagged) - Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ENTPD8 (mGFP-tagged) - Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ENTPD8 (Myc-DDK-tagged)-Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ENTPD8 (Myc-DDK-tagged)-Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ENTPD8 (mGFP-tagged)-Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ENTPD8 (mGFP-tagged)-Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ENTPD8 (GFP-tagged) - Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Entpd8 (Myc-DDK-tagged ORF) - Rat ectonucleoside triphosphate diphosphohydrolase 8 (Entpd8), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Entpd8 (Myc-DDK-tagged ORF) - Rat ectonucleoside triphosphate diphosphohydrolase 8 (Entpd8), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Entpd8 (Myc-DDK-tagged ORF) - Rat ectonucleoside triphosphate diphosphohydrolase 8 (Entpd8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Entpd8 (mGFP-tagged ORF) - Rat ectonucleoside triphosphate diphosphohydrolase 8 (Entpd8), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Entpd8 (GFP-tagged ORF) - Rat ectonucleoside triphosphate diphosphohydrolase 8 (Entpd8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ENTPD8 (untagged)-Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Entpd8 (untagged) - Mouse ectonucleoside triphosphate diphosphohydrolase 8 (Entpd8), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ENTPD8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENTPD8 Antibody: synthetic peptide directed towards the N terminal of human ENTPD8. Synthetic peptide located within the following region: IPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWG |
ENTPD8 CRISPRa kit - CRISPR gene activation of human ectonucleoside triphosphate diphosphohydrolase 8
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Entpd8 CRISPRa kit - CRISPR gene activation of mouse ectonucleoside triphosphate diphosphohydrolase 8
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene ENTPD8
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
ENTPD8 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Entpd8
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Entpd8
ENTPD8 MS Standard C13 and N15-labeled recombinant protein (NP_001028285)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Entpd8 (untagged ORF) - Rat ectonucleoside triphosphate diphosphohydrolase 8 (Entpd8), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ENTPD8 (untagged)-Human ectonucleoside triphosphate diphosphohydrolase 8 (ENTPD8), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
ENTPD8 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Entpd8 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR426994 is the updated version of SR415980.
Entpd8 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression of ENTPD8 (NM_001033113) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ENTPD8 (NM_198585) in HEK293T cells paraffin embedded controls for ICC/IHC staining
ENTPD8 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
ENTPD8 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Entpd8 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Entpd8 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Entpd8 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Entpd8 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse ectonucleoside triphosphate diphosphohydrolase 8 (Entpd8), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| Tag | C-MYC/DDK |
| Expression Host | HEK293T |
Active filters
Target Symbol
- ENTPD8