Germany
Japan
United Kingdom
China
PDE7B (Myc-DDK-tagged)-Human phosphodiesterase 7B (PDE7B)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human phosphodiesterase 7B (PDE7B)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, PDE7B (Myc-DDK tagged) - Human phosphodiesterase 7B (PDE7B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PDE7B (mGFP-tagged) - Human phosphodiesterase 7B (PDE7B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PDE7B (GFP-tagged) - Human phosphodiesterase 7B (PDE7B)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human phosphodiesterase 7B (PDE7B), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PDE7B (Myc-DDK tagged) - Human phosphodiesterase 7B (PDE7B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phosphodiesterase 7B (PDE7B), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PDE7B (mGFP-tagged) - Human phosphodiesterase 7B (PDE7B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phosphodiesterase 7B (PDE7B), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Phosphodiesterase 7b / PDE7B Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | PDE7B antibody was raised against synthetic 17 amino acid peptide from near N-terminus of human PDE7B. Percent identity with other species by BLAST analysis: Human (100%); Gibbon, Monkey (94%); Gorilla, Mouse, Rat, Elephant, Horse, Rabbit (88%); Opossum (82%). |
Lenti ORF clone of Human phosphodiesterase 7B (PDE7B), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-PDE7B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDE7B Antibody: synthetic peptide directed towards the middle region of human PDE7B. Synthetic peptide located within the following region: IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN |
PDE7B (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 424-454 amino acids from the C-terminal region of Human PDE7B |
Phosphodiesterase 7b / PDE7B Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey |
| Immunogen | PDE7B antibody was raised against synthetic 18 amino acid peptide from internal region of human PDE7B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Turkey, Chicken (94%); Platypus (89%). |
Phosphodiesterase 7b / PDE7B Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Immunogen | PDE7B antibody was raised against synthetic 19 amino acid peptide from C-terminus of human PDE7B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset (95%). |
PDE7B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of phosphodiesterase 7B (PDE7B)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PDE7B MS Standard C13 and N15-labeled recombinant protein (NP_061818)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PDE7B (untagged)-Human phosphodiesterase 7B (PDE7B)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of PDE7B (NM_018945) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDE7B (NM_018945) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PDE7B (NM_018945) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PDE7B
Pathways
- Purine metabolism