Germany
Japan
United Kingdom
China
POLR2C (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide C, 33kDa (POLR2C)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
POLR2C (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide C, 33kDa (POLR2C)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide C, 33kDa (POLR2C), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, POLR2C (Myc-DDK tagged) - Human polymerase (RNA) II (DNA directed) polypeptide C, 33kDa (POLR2C), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide C, 33kDa (POLR2C), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, POLR2C (mGFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide C, 33kDa (POLR2C), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit polyclonal anti-POLR2C antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This POLR2C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-228 amino acids from the C-terminal region of human POLR2C. |
Rabbit anti-POLR2C Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human POLR2C |
Rabbit Polyclonal Anti-POLR2C Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Polr2c antibody is: synthetic peptide directed towards the C-terminal region of Mouse Polr2c. Synthetic peptide located within the following region: YDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERLGDLGPR |
POLR2C (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide C, 33kDa (POLR2C)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human polymerase (RNA) II (DNA directed) polypeptide C, 33kDa (POLR2C), full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-GST and C-His |
| Expression Host | E. coli |
Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide C, 33kDa (POLR2C)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
POLR2C (1-275, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
POLR2C (1-275, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
POLR2C HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression of POLR2C (NM_032940) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of POLR2C (NM_032940) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of POLR2C (NM_032940) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- POLR2C
Pathways
- Purine metabolism