Products

View as table Download

POLR3F (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

POLR3F (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, POLR3F (Myc-DDK tagged) - Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, POLR3F (mGFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

POLR3F (myc-DDK-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-POLR3F Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3F antibody: synthetic peptide directed towards the middle region of human POLR3F. Synthetic peptide located within the following region: LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVE

Rabbit Polyclonal Anti-POLR3F Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3F antibody: synthetic peptide directed towards the N terminal of human POLR3F. Synthetic peptide located within the following region: MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQR

POLR3F (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal POLR3F Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen POLR3F antibody was raised against a 21 amino acid peptide from near the amino terminus of human POLR3F.

POLR3F (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, POLR3F antibody was raised against a 21 amino acid peptide from near the amino terminus of human POLR3F.

POLR3F HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Purified recombinant protein of Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli

POLR3F (1-316, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

POLR3F (1-316, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

POLR3F (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

POLR3F (untagged) - Human polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa (POLR3F), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of POLR3F (NM_006466) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of POLR3F (NM_001282526) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of POLR3F (NM_006466) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of POLR3F (NM_006466) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of POLR3F (NM_001282526) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack