Products

View as table Download

ALDH9A1 (Myc-DDK-tagged)-Human aldehyde dehydrogenase 9 family, member A1 (ALDH9A1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human aldehyde dehydrogenase 9 family, member A1 (ALDH9A1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ALDH9A1 (Myc-DDK tagged) - Human aldehyde dehydrogenase 9 family, member A1 (ALDH9A1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human aldehyde dehydrogenase 9 family, member A1 (ALDH9A1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ALDH9A1 (mGFP-tagged) - Human aldehyde dehydrogenase 9 family, member A1 (ALDH9A1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ALDH9A1 (GFP-tagged) - Human aldehyde dehydrogenase 9 family, member A1 (ALDH9A1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ALDH9A1 (untagged)-Human aldehyde dehydrogenase 9 family, member A1 (ALDH9A1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

ALDH9A1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Goat Anti-ALDH9A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKEILDKFTEEVVKQ, from the internal region of the protein sequence according to NP_000687.3.

Rabbit Polyclonal Anti-ALDH9A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH9A1 antibody: synthetic peptide directed towards the C terminal of human ALDH9A1. Synthetic peptide located within the following region: MGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPC

Goat Anti-ALDH9A1, Biotinylated Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKEILDKFTEEVVKQ., from the internal region of the protein sequence according to NP_000687.3.

ALDH9A1 MS Standard C13 and N15-labeled recombinant protein (NP_000687)

Tag C-Myc/DDK
Expression Host HEK293

ALDH9A1 (untagged)-Human aldehyde dehydrogenase 9 family, member A1 (ALDH9A1)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Anti-ALDH9A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1

Anti-ALDH9A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1

Rabbit polyclonal anti-ALDH9A1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH9A1

Rabbit polyclonal anti-ALDH9A1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH9A1

USD 1,070.00

4 Weeks

Transient overexpression of ALDH9A1 (NM_000696) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of ALDH9A1 (NM_000696) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ALDH9A1 (NM_000696) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack