Germany
Japan
United Kingdom
China
ALDH9A1 (Myc-DDK-tagged)-Human aldehyde dehydrogenase 9 family, member A1 (ALDH9A1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Aldh9a1 (Myc-DDK-tagged) - Mouse aldehyde dehydrogenase 9, subfamily A1 (Aldh9a1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ALDH9A1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN416921 is the updated version of KN216921.
Aldh9a1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN501128 is the updated version of KN301128.
Aldh9a1 (GFP-tagged) - Mouse aldehyde dehydrogenase 9, subfamily A1 (cDNA clone MGC:6698 IMAGE:3583976)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Aldh9a1 (Myc-DDK-tagged) - Mouse aldehyde dehydrogenase 9, subfamily A1 (Aldh9a1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Aldh9a1 (Myc-DDK-tagged) - Mouse aldehyde dehydrogenase 9, subfamily A1 (Aldh9a1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Aldh9a1 (mGFP-tagged) - Mouse aldehyde dehydrogenase 9, subfamily A1 (Aldh9a1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Aldh9a1 (GFP-tagged) - Mouse aldehyde dehydrogenase 9, subfamily A1 (Aldh9a1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human aldehyde dehydrogenase 9 family, member A1 (ALDH9A1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ALDH9A1 (Myc-DDK tagged) - Human aldehyde dehydrogenase 9 family, member A1 (ALDH9A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human aldehyde dehydrogenase 9 family, member A1 (ALDH9A1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ALDH9A1 (mGFP-tagged) - Human aldehyde dehydrogenase 9 family, member A1 (ALDH9A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ALDH9A1 (GFP-tagged) - Human aldehyde dehydrogenase 9 family, member A1 (ALDH9A1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Aldh9a1 (Myc-DDK-tagged ORF) - Rat aldehyde dehydrogenase 9 family, member A1 (Aldh9a1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Aldh9a1 (Myc-DDK-tagged ORF) - Rat aldehyde dehydrogenase 9 family, member A1 (Aldh9a1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Aldh9a1 (Myc-DDK-tagged ORF) - Rat aldehyde dehydrogenase 9 family, member A1 (Aldh9a1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Aldh9a1 (mGFP-tagged ORF) - Rat aldehyde dehydrogenase 9 family, member A1 (Aldh9a1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Aldh9a1 (GFP-tagged ORF) - Rat aldehyde dehydrogenase 9 family, member A1 (Aldh9a1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ALDH9A1 (untagged)-Human aldehyde dehydrogenase 9 family, member A1 (ALDH9A1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Aldh9a1 (untagged) - Mouse aldehyde dehydrogenase 9, subfamily A1 (cDNA clone MGC:6698 IMAGE:3583976), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ALDH9A1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of aldehyde dehydrogenase 9 family, member A1 (ALDH9A1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-ALDH9A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH9A1 antibody: synthetic peptide directed towards the C terminal of human ALDH9A1. Synthetic peptide located within the following region: MGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPC |
Goat Anti-ALDH9A1, Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QKEILDKFTEEVVKQ., from the internal region of the protein sequence according to NP_000687.3. |
ALDH9A1 CRISPRa kit - CRISPR gene activation of human aldehyde dehydrogenase 9 family member A1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Aldh9a1 CRISPRa kit - CRISPR gene activation of mouse aldehyde dehydrogenase 9, subfamily A1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene ALDH9A1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene ALDH9A1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
qSTAR qPCR primer pairs against Mus musculus gene Aldh9a1
ALDH9A1 MS Standard C13 and N15-labeled recombinant protein (NP_000687)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Aldh9a1 (untagged ORF) - Rat aldehyde dehydrogenase 9 family, member A1 (Aldh9a1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of aldehyde dehydrogenase 9 family member A1 (ALDH9A1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
ALDH9A1 (untagged)-Human aldehyde dehydrogenase 9 family, member A1 (ALDH9A1)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ALDH9A1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Aldh9a1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Aldh9a1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anti-ALDH9A1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1 |
ALDH9A1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human AL9A1 |
ALDH9A1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ALDH9A1 |
| Modifications | Unmodified |
Transient overexpression of ALDH9A1 (NM_000696) in HEK293T cells paraffin embedded controls for ICC/IHC staining
ALDH9A1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
ALDH9A1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Aldh9a1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Aldh9a1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Aldh9a1 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- ALDH9A1
Filter by
Species
Antibody Hosts
Isotypes
Clonalities
Conjugates
Expression Hosts
Lentivirus
Vectors
Modifications
Mutants
Mammalian Cell Selection
Families
Pathways
- Arginine and proline metabolism (21)
- Ascorbate and aldarate metabolism (21)
- Butanoate metabolism (21)
- Fatty acid metabolism (21)
- Glycerolipid metabolism (21)
- Glycolysis / Gluconeogenesis (21)
- Histidine metabolism (21)
- Limonene and pinene degradation (21)
- Lysine degradation (21)
- Metabolic pathways (21)
- Propanoate metabolism (21)
- Pyruvate metabolism (21)
- Tryptophan metabolism (21)
- Valine (21)
- beta-Alanine metabolism (21)
- leucine and isoleucine degradation (21)