Germany
Japan
United Kingdom
China
MAPK12 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 12 (MAPK12)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
3 Weeks
Lenti ORF particles, MAPK12 (Myc-DDK tagged) - Human mitogen-activated protein kinase 12 (MAPK12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, MAPK12 (mGFP-tagged) - Human mitogen-activated protein kinase 12 (MAPK12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
MAPK12 (GFP-tagged) - Human mitogen-activated protein kinase 12 (MAPK12)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human mitogen-activated protein kinase 12 (MAPK12), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, MAPK12 (Myc-DDK tagged) - Human mitogen-activated protein kinase 12 (MAPK12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human mitogen-activated protein kinase 12 (MAPK12), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, MAPK12 (mGFP-tagged) - Human mitogen-activated protein kinase 12 (MAPK12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MAPK12 (myc-DDK-tagged) - Human mitogen-activated protein kinase 12 (MAPK12), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human mitogen-activated protein kinase 12 (MAPK12), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of mitogen-activated protein kinase 12 (MAPK12)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human mitogen-activated protein kinase 12 (MAPK12), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
MAPK12 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
MAPK12 (untagged)-Kinase deficient mutant (K56M) of Human mitogen-activated protein kinase 12 (MAPK12)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC323663 is the updated version of SC118306.
Recombinant protein of human mitogen-activated protein kinase 12 (MAPK12), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Rabbit polyclonal Anti-MAPK12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAPK12 antibody: synthetic peptide directed towards the N terminal of human MAPK12. Synthetic peptide located within the following region: SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE |
Rabbit polyclonal Anti-Mapk12 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk12 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ERMLVLDAEQRVTAAEALTHPYFESLRDTEDEPKAQKYDDSFDDVDRTLE |
MAPK12 (1-367, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
MAPK12 (1-367, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
MAPK12 (GFP-tagged) - Human mitogen-activated protein kinase 12 (MAPK12), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAPK12 (untagged)-Human mitogen-activated protein kinase 12 (MAPK12)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
(untagged)-Human cDNA FLJ40739 fis, clone TKIDN2004748, highly similar to MITOGEN-ACTIVATED PROTEIN KINASE 12 (EC 2.7.1.-)
| Vector | pCMV6 series |
| Tag | Tag Free |
MAPK12 (untagged) - Human mitogen-activated protein kinase 12 (MAPK12), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-MAPK12 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MAPK12 |
MAPK12 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human MAPK12 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of MAPK12 (NM_002969) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAPK12 (NM_001303252) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAPK12 (NM_002969) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAPK12 (NM_002969) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MAPK12 (NM_001303252) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- MAPK12
Pathways
- RIG-I-like receptor signaling pathway