Germany
Japan
United Kingdom
China
MAVS (Myc-DDK-tagged)-Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human virus-induced signaling adapter (VISA), nuclear gene encoding mitochondrial protein
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
MAVS (GFP-tagged) - Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, MAVS (Myc-DDK tagged) - Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, MAVS (mGFP-tagged) - Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, MAVS (Myc-DDK tagged) - Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, MAVS (mGFP-tagged) - Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MAVS (Myc-DDK tagged) - Homo sapiens mitochondrial antiviral signaling protein (MAVS), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAVS (GFP-tagged) - Homo sapiens mitochondrial antiviral signaling protein (MAVS), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit anti-MAVS Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MAVS |
Lenti ORF clone of Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
MAVS (untagged)-Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-MAVS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ |
Lenti ORF clone of Human mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
MAVS HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of mitochondrial antiviral signaling protein (MAVS), nuclear gene encoding mitochondrial protein
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-MAVS Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the N terminal of human VISA. Synthetic peptide located within the following region: ETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGH |
Mouse Monoclonal MAVS Antibody (58N2B2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAVS (1-513, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
MAVS (1-513, His-tag) human recombinant protein, 10 µg
| Tag | His-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAVS MS Standard C13 and N15-labeled recombinant protein (NP_065797)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
MAVS (untagged) - Homo sapiens mitochondrial antiviral signaling protein (MAVS), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
USD 420.00
4 Weeks
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of MAVS (NM_020746) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAVS (NM_001206491) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAVS (NM_020746) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAVS (NM_020746) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MAVS (NM_001206491) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- MAVS
Pathways
- RIG-I-like receptor signaling pathway