Products

Primary Antibodies (8)
View as table Download

Rabbit Polyclonal Anti-DCP1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCP1A antibody: synthetic peptide directed towards the N terminal of human DCP1A. Synthetic peptide located within the following region: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDI

Rabbit Polyclonal Anti-DCP1A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DCP1A Antibody: A synthesized peptide derived from human DCP1A

Rabbit polyclonal DCP1A antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DCP1A.

DCP1A rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 102-150 of Human SMIF.

Goat Polyclonal Antibody against DCP1A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QVLTKNKDNHN, from the C Terminus of the protein sequence according to NP_060873.3.

Rabbit anti-Dcp1a polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH

Rabbit Polyclonal Anti-DCP1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCP1A antibody: synthetic peptide directed towards the N terminal of human DCP1A. Synthetic peptide located within the following region: EEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGD

Rabbit Polyclonal Anti-DCP1A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DCP1A