Products

View as table Download

CNOT2 (Myc-DDK-tagged)-Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

CNOT2 (GFP-tagged) - Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CNOT2 (Myc-DDK tagged) - Homo sapiens CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CNOT2 (Myc-DDK tagged) - Homo sapiens CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CNOT2 (Myc-DDK tagged) - Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CNOT2 (mGFP-tagged) - Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CNOT2 (GFP-tagged) - Homo sapiens CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CNOT2 (GFP-tagged) - Homo sapiens CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CNOT2 (untagged)-Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Recombinant protein of human CCR4-NOT transcription complex, subunit 2 (CNOT2), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

Rabbit polyclonal CNOT2 (Ab-101) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G).

Rabbit polyclonal CNOT2 (Ser101) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G).
Modifications Phospho-specific

CNOT2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-CNOT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNOT2 antibody: synthetic peptide directed towards the middle region of human CNOT2. Synthetic peptide located within the following region: SYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQ

Rabbit Polyclonal Anti-CNOT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNOT2 antibody: synthetic peptide directed towards the middle region of human CNOT2. Synthetic peptide located within the following region: PLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKS

Carrier-free (BSA/glycerol-free) CNOT2 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CNOT2 mouse monoclonal antibody, clone OTI6D7 (formerly 6D7)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CNOT2 mouse monoclonal antibody, clone OTI9B10 (formerly 9B10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CNOT2 (untagged) - Homo sapiens CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 3

Vector pCMV6 series
Tag Tag Free

CNOT2 (untagged) - Homo sapiens CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 1

Vector pCMV6 series
Tag Tag Free

CNOT2 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CNOT2 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CNOT2 mouse monoclonal antibody, clone OTI6D7 (formerly 6D7)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CNOT2 mouse monoclonal antibody, clone OTI6D7 (formerly 6D7)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CNOT2 mouse monoclonal antibody, clone OTI9B10 (formerly 9B10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CNOT2 mouse monoclonal antibody, clone OTI9B10 (formerly 9B10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

USD 1,070.00

4 Weeks

Transient overexpression of CNOT2 (NM_014515) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of CNOT2 (NM_001199302) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of CNOT2 (NM_001199303) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of CNOT2 (NM_014515) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of CNOT2 (NM_014515) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of CNOT2 (NM_001199302) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of CNOT2 (NM_001199302) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of CNOT2 (NM_001199303) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of CNOT2 (NM_001199303) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack