CNOT2 (Myc-DDK-tagged)-Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CNOT2 (Myc-DDK-tagged)-Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CNOT2 (GFP-tagged) - Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CNOT2 (Myc-DDK tagged) - Homo sapiens CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CNOT2 (Myc-DDK tagged) - Homo sapiens CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CNOT2 (Myc-DDK tagged) - Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CNOT2 (mGFP-tagged) - Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CNOT2 (GFP-tagged) - Homo sapiens CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CNOT2 (GFP-tagged) - Homo sapiens CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of CCR4-NOT transcription complex, subunit 2 (CNOT2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CNOT2 (untagged)-Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human CCR4-NOT transcription complex, subunit 2 (CNOT2), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Rabbit polyclonal CNOT2 (Ab-101) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G). |
Rabbit polyclonal CNOT2 (Ser101) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G). |
Modifications | Phospho-specific |
CNOT2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-CNOT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CNOT2 antibody: synthetic peptide directed towards the middle region of human CNOT2. Synthetic peptide located within the following region: SYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQ |
Rabbit Polyclonal Anti-CNOT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CNOT2 antibody: synthetic peptide directed towards the middle region of human CNOT2. Synthetic peptide located within the following region: PLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKS |
Carrier-free (BSA/glycerol-free) CNOT2 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT2 mouse monoclonal antibody, clone OTI6D7 (formerly 6D7)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT2 mouse monoclonal antibody, clone OTI9B10 (formerly 9B10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT2 (untagged) - Homo sapiens CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
CNOT2 (untagged) - Homo sapiens CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 1
Vector | pCMV6 series |
Tag | Tag Free |
CNOT2 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CNOT2 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
CNOT2 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CNOT2 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT2 mouse monoclonal antibody, clone OTI6D7 (formerly 6D7)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CNOT2 mouse monoclonal antibody, clone OTI6D7 (formerly 6D7), Biotinylated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
CNOT2 mouse monoclonal antibody, clone OTI6D7 (formerly 6D7), HRP conjugated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CNOT2 mouse monoclonal antibody, clone OTI6D7 (formerly 6D7)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT2 mouse monoclonal antibody, clone OTI9B10 (formerly 9B10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CNOT2 mouse monoclonal antibody, clone OTI9B10 (formerly 9B10), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
CNOT2 mouse monoclonal antibody, clone OTI9B10 (formerly 9B10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CNOT2 mouse monoclonal antibody, clone OTI9B10 (formerly 9B10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of CNOT2 (NM_014515) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CNOT2 (NM_001199302) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CNOT2 (NM_001199303) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CNOT2 (NM_014515) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CNOT2 (NM_014515) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CNOT2 (NM_001199302) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CNOT2 (NM_001199302) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CNOT2 (NM_001199303) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CNOT2 (NM_001199303) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack