Germany
Japan
United Kingdom
China
CNOT2 (Myc-DDK-tagged)-Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CNOT2 (GFP-tagged) - Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CNOT2 (Myc-DDK tagged) - Homo sapiens CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CNOT2 (Myc-DDK tagged) - Homo sapiens CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CNOT2 (Myc-DDK tagged) - Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CNOT2 (mGFP-tagged) - Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CNOT2 (GFP-tagged) - Homo sapiens CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CNOT2 (GFP-tagged) - Homo sapiens CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Transient overexpression lysate of CCR4-NOT transcription complex, subunit 2 (CNOT2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CNOT2 (untagged)-Human CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 2
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human CCR4-NOT transcription complex, subunit 2 (CNOT2), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Rabbit polyclonal CNOT2 (Ab-101) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G). |
Rabbit polyclonal CNOT2 (Ser101) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G). |
| Modifications | Phospho-specific |
CNOT2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-CNOT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT2 antibody: synthetic peptide directed towards the middle region of human CNOT2. Synthetic peptide located within the following region: SYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQ |
Rabbit Polyclonal Anti-CNOT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT2 antibody: synthetic peptide directed towards the middle region of human CNOT2. Synthetic peptide located within the following region: PLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKS |
CNOT2 (untagged) - Homo sapiens CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
CNOT2 (untagged) - Homo sapiens CCR4-NOT transcription complex, subunit 2 (CNOT2), transcript variant 1
| Vector | pCMV6 series |
| Tag | Tag Free |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of CNOT2 (NM_014515) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CNOT2 (NM_001199302) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CNOT2 (NM_001199303) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CNOT2 (NM_014515) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CNOT2 (NM_014515) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CNOT2 (NM_001199302) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CNOT2 (NM_001199302) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CNOT2 (NM_001199303) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CNOT2 (NM_001199303) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CNOT2
Pathways
- RNA degradation