Products

cDNA Clones (14)
Proteins (7)
Antibodies (1)
Jump to Filters
View as table Download
CNOT6 (NM_015455) Human Tagged ORF Clone
RC219771

USD 580.00

In Stock

CNOT6 (Myc-DDK-tagged)-Human CCR4-NOT transcription complex, subunit 6 (CNOT6)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CNOT6 (NM_015455) Human Tagged ORF Clone Lentiviral Particle
RC219771L1V

USD 980.00

6 Weeks

Lenti ORF particles, CNOT6 (Myc-DDK tagged) - Human CCR4-NOT transcription complex, subunit 6 (CNOT6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CNOT6 (NM_015455) Human Tagged ORF Clone Lentiviral Particle
RC219771L2V

USD 980.00

6 Weeks

Lenti ORF particles, CNOT6 (mGFP-tagged) - Human CCR4-NOT transcription complex, subunit 6 (CNOT6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CNOT6 (NM_015455) Human Tagged ORF Clone
RC219771L3

USD 780.00

3 Weeks

Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 6 (CNOT6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CNOT6 (NM_015455) Human Tagged ORF Clone Lentiviral Particle
RC219771L3V

USD 980.00

6 Weeks

Lenti ORF particles, CNOT6 (Myc-DDK tagged) - Human CCR4-NOT transcription complex, subunit 6 (CNOT6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CNOT6 (NM_015455) Human Tagged ORF Clone
RC219771L4

USD 780.00

3 Weeks

Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 6 (CNOT6), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CNOT6 (NM_015455) Human Tagged ORF Clone Lentiviral Particle
RC219771L4V

USD 980.00

6 Weeks

Lenti ORF particles, CNOT6 (mGFP-tagged) - Human CCR4-NOT transcription complex, subunit 6 (CNOT6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CNOT6 (NM_001303241) Human Tagged ORF Clone
RC238889

USD 580.00

3 Weeks

CNOT6 (myc-DDK-tagged) - Human CCR4-NOT transcription complex, subunit 6 (CNOT6)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CNOT6 (NM_015455) Human Tagged ORF Clone
RG219771

USD 640.00

3 Weeks

CNOT6 (GFP-tagged) - Human CCR4-NOT transcription complex, subunit 6 (CNOT6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CNOT6 Rabbit Polyclonal Antibody
TA343830

USD 475.00

5 Days

Rabbit Polyclonal Anti-CNOT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNOT6 antibody: synthetic peptide directed towards the N terminal of human CNOT6. Synthetic peptide located within the following region: EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN
CNOT6 (NM_015455) Human Tagged ORF Clone
RC219771L1

USD 780.00

3 Weeks

Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 6 (CNOT6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CNOT6 (NM_015455) Human Tagged ORF Clone
RC219771L2

USD 780.00

3 Weeks

Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 6 (CNOT6), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CNOT6 (NM_015455) Human Over-expression Lysate
LC414536

USD 187.00

In Stock

CNOT6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CNOT6 (NM_015455) Human Over-expression Lysate
LY414536

USD 605.00

In Stock

Transient overexpression lysate of CCR4-NOT transcription complex, subunit 6 (CNOT6)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CNOT6 (NM_001303241) Human Tagged ORF Clone
RG238889

USD 620.00

2 Weeks

CNOT6 (GFP-tagged) - Human CCR4-NOT transcription complex, subunit 6 (CNOT6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CNOT6 (NM_015455) Human Untagged Clone
SC313993

USD 950.00

3 Weeks

CNOT6 (untagged)-Human CCR4-NOT transcription complex, subunit 6 (CNOT6)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CNOT6 (NM_001303241) Human Untagged Clone
SC336783

USD 570.00

3 Weeks

CNOT6 (untagged) - Human CCR4-NOT transcription complex, subunit 6 (CNOT6)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CNOT6 (NM_015455) ICC Control Block
TB419771

USD 1,230.00

4 Weeks

Transient overexpression of CNOT6 (NM_015455) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CNOT6 (NM_001303241) ICC Control Block
TB438889

USD 1,230.00

4 Weeks

Transient overexpression of CNOT6 (NM_001303241) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CNOT6 Cytosection
TS419771

USD 225.00

4 Weeks

Transient overexpression of CNOT6 (NM_015455) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CNOT6 ICC Control Sections
TS419771P5

USD 889.00

4 Weeks

Transient overexpression of CNOT6 (NM_015455) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CNOT6 ICC Control Sections
TS438889P5

USD 889.00

4 Weeks

Transient overexpression of CNOT6 (NM_001303241) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack