CNOT6 (Myc-DDK-tagged)-Human CCR4-NOT transcription complex, subunit 6 (CNOT6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CNOT6 (Myc-DDK-tagged)-Human CCR4-NOT transcription complex, subunit 6 (CNOT6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CNOT6 (Myc-DDK tagged) - Human CCR4-NOT transcription complex, subunit 6 (CNOT6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CNOT6 (mGFP-tagged) - Human CCR4-NOT transcription complex, subunit 6 (CNOT6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 6 (CNOT6), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CNOT6 (Myc-DDK tagged) - Human CCR4-NOT transcription complex, subunit 6 (CNOT6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 6 (CNOT6), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CNOT6 (mGFP-tagged) - Human CCR4-NOT transcription complex, subunit 6 (CNOT6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CNOT6 (myc-DDK-tagged) - Human CCR4-NOT transcription complex, subunit 6 (CNOT6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CNOT6 (GFP-tagged) - Human CCR4-NOT transcription complex, subunit 6 (CNOT6)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CNOT6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CNOT6 antibody: synthetic peptide directed towards the N terminal of human CNOT6. Synthetic peptide located within the following region: EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN |
Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 6 (CNOT6), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 6 (CNOT6), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CNOT6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of CCR4-NOT transcription complex, subunit 6 (CNOT6)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CNOT6 (GFP-tagged) - Human CCR4-NOT transcription complex, subunit 6 (CNOT6)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CNOT6 (untagged)-Human CCR4-NOT transcription complex, subunit 6 (CNOT6)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CNOT6 (untagged) - Human CCR4-NOT transcription complex, subunit 6 (CNOT6)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of CNOT6 (NM_015455) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CNOT6 (NM_001303241) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CNOT6 (NM_015455) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CNOT6 (NM_015455) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CNOT6 (NM_001303241) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack