CNOT6L (Myc-DDK-tagged)-Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CNOT6L (Myc-DDK-tagged)-Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 880.00
3 Weeks
Lenti ORF particles, CNOT6L (Myc-DDK tagged) - Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 880.00
6 Weeks
Lenti ORF particles, CNOT6L (mGFP-tagged) - Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CNOT6L (GFP-tagged) - Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CNOT6L (myc-DDK-tagged) - Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 880.00
7 Weeks
Lenti ORF particles, CNOT6L (Myc-DDK tagged) - Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 880.00
7 Weeks
Lenti ORF particles, CNOT6L (mGFP-tagged) - Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CNOT6L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CNOT6L antibody is: synthetic peptide directed towards the middle region of Human CNOT6L. Synthetic peptide located within the following region: AKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQVAMANSDGSEAMLN |
CNOT6L HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of CCR4-NOT transcription complex, subunit 6-like (CNOT6L)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
CNOT6L MS Standard C13 and N15-labeled recombinant protein (NP_653172)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CNOT6L (GFP-tagged) - Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CNOT6L (untagged)-Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CNOT6L (untagged) - Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L), transcript variant 1
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of CNOT6L (NM_144571) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CNOT6L (NM_001286790) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CNOT6L (NM_144571) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CNOT6L (NM_144571) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CNOT6L (NM_001286790) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CNOT6L (NM_001286790) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack