Products

View as table Download

CNOT6L (Myc-DDK-tagged)-Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

CNOT6L (GFP-tagged) - Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CNOT6L (myc-DDK-tagged) - Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CNOT6L (Myc-DDK tagged) - Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-CNOT6L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CNOT6L antibody is: synthetic peptide directed towards the middle region of Human CNOT6L. Synthetic peptide located within the following region: AKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQVAMANSDGSEAMLN

CNOT6L HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

CNOT6L MS Standard C13 and N15-labeled recombinant protein (NP_653172)

Tag C-Myc/DDK
Expression Host HEK293

CNOT6L (GFP-tagged) - Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CNOT6L (untagged)-Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

CNOT6L (untagged) - Human CCR4-NOT transcription complex, subunit 6-like (CNOT6L), transcript variant 1

Vector pCMV6 series
Tag Tag Free

Transient overexpression of CNOT6L (NM_144571) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CNOT6L (NM_001286790) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CNOT6L (NM_144571) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of CNOT6L (NM_144571) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of CNOT6L (NM_001286790) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of CNOT6L (NM_001286790) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack