EXOSC4 (Myc-DDK-tagged)-Human exosome component 4 (EXOSC4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EXOSC4 (Myc-DDK-tagged)-Human exosome component 4 (EXOSC4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, EXOSC4 (Myc-DDK tagged) - Human exosome component 4 (EXOSC4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, EXOSC4 (mGFP-tagged) - Human exosome component 4 (EXOSC4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human exosome component 4 (EXOSC4), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EXOSC4 (Myc-DDK tagged) - Human exosome component 4 (EXOSC4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human exosome component 4 (EXOSC4), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, EXOSC4 (mGFP-tagged) - Human exosome component 4 (EXOSC4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
EXOSC4 (GFP-tagged) - Human exosome component 4 (EXOSC4)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-EXOSC4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EXOSC4 antibody: synthetic peptide directed towards the N terminal of human EXOSC4. Synthetic peptide located within the following region: SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE |
Lenti ORF clone of Human exosome component 4 (EXOSC4), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human exosome component 4 (EXOSC4), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
EXOSC4 (untagged)-Human exosome component 4 (EXOSC4)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
EXOSC4 (1-245, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
EXOSC4 (1-245, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
EXOSC4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of exosome component 4 (EXOSC4)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression of EXOSC4 (NM_019037) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of EXOSC4 (NM_019037) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of EXOSC4 (NM_019037) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack