Products

cDNA Clones (11)
Proteins (7)
Antibodies (1)
Jump to Filters
View as table Download
EXOSC4 (NM_019037) Human Tagged ORF Clone
RC201058

USD 98.00

USD 390.00

In Stock

EXOSC4 (Myc-DDK-tagged)-Human exosome component 4 (EXOSC4)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
EXOSC4 (NM_019037) Human Tagged ORF Clone
RC201058L3

USD 620.00

3 Weeks

Lenti ORF clone of Human exosome component 4 (EXOSC4), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
EXOSC4 (NM_019037) Human Tagged ORF Clone
RC201058L4

USD 620.00

3 Weeks

Lenti ORF clone of Human exosome component 4 (EXOSC4), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
EXOSC4 (NM_019037) Human Tagged ORF Clone
RG201058

USD 460.00

3 Weeks

EXOSC4 (GFP-tagged) - Human exosome component 4 (EXOSC4)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
EXOSC4 Rabbit Polyclonal Antibody
TA343890

USD 410.00

5 Days

Rabbit Polyclonal Anti-EXOSC4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC4 antibody: synthetic peptide directed towards the N terminal of human EXOSC4. Synthetic peptide located within the following region: SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE
EXOSC4 (NM_019037) Human Tagged ORF Clone
RC201058L1

USD 768.00

In Stock

Lenti ORF clone of Human exosome component 4 (EXOSC4), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
EXOSC4 (NM_019037) Human Tagged ORF Clone
RC201058L2

USD 620.00

3 Weeks

Lenti ORF clone of Human exosome component 4 (EXOSC4), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
EXOSC4 (NM_019037) Human Untagged Clone
SC113302

USD 310.00

In Stock

EXOSC4 (untagged)-Human exosome component 4 (EXOSC4)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
EXOSC4 (1-245, His-tag) Human Protein
AR51236PU-N

USD 1,105.00

2 Weeks

EXOSC4 (1-245, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
EXOSC4 (1-245, His-tag) Human Protein
AR51236PU-S

USD 415.00

2 Weeks

EXOSC4 (1-245, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
EXOSC4 (NM_019037) Human Over-expression Lysate
LC412805

USD 121.00

2 Weeks

EXOSC4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EXOSC4 (NM_019037) Human Over-expression Lysate
LY412805

USD 396.00

5 Days

Transient overexpression lysate of exosome component 4 (EXOSC4)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
EXOSC4 (NM_019037) ICC Control Block
TB401058

USD 1,040.00

4 Weeks

Transient overexpression of EXOSC4 (NM_019037) in HEK293T cells paraffin embedded controls for ICC/IHC staining

EXOSC4 Cytosection
TS401058

USD 225.00

4 Weeks

Transient overexpression of EXOSC4 (NM_019037) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

EXOSC4 Cytosection
TS401058P5

USD 889.00

4 Weeks

Transient overexpression of EXOSC4 (NM_019037) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack