Germany
Japan
United Kingdom
China
LSM4 (Myc-DDK-tagged)-Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, LSM4 (Myc-DDK tagged) - Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, LSM4 (mGFP-tagged) - Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
LSM4 (GFP-tagged) - Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LSM4 (Myc-DDK tagged) - Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LSM4 (mGFP-tagged) - Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
LSM4 (myc-DDK-tagged) - Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-LSM4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSM4 antibody: synthetic peptide directed towards the middle region of human LSM4. Synthetic peptide located within the following region: GRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGK |
Lenti ORF clone of Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit anti-LSM4 Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LSM4 |
Recombinant protein of human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression lysate of LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
LSM4 (untagged)-Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
LSM4 (1-139, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
LSM4 (1-139, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
LSM4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LSM4 (GFP-tagged) - Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
LSM4 (untagged) - Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of LSM4 (NM_012321) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LSM4 (NM_001252129) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4)
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4)
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4)
| Tag | N-His |
| Expression Host | E. coli |
Recombinant protein of human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4)
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression of LSM4 (NM_012321) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LSM4 (NM_012321) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of LSM4 (NM_001252129) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- LSM4
Pathways
- RNA degradation